HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)

Gene

• Entrez ID: 3125
• Gene name: Major histocompatibility complex, class II, DR beta 3
• Gene symbol: HLA-DRB3
• Synonyms: DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*
• Chromosome: 6
• Chromosome location: 6p21.3
• Summary: HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides der

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1048461	hsa-miR-320a	CLIP-seq
MIRT1048462	hsa-miR-320b	CLIP-seq
MIRT1048463	hsa-miR-320c	CLIP-seq
MIRT1048464	hsa-miR-320d	CLIP-seq
MIRT1048465	hsa-miR-320e	CLIP-seq
MIRT1048466	hsa-miR-4429	CLIP-seq
MIRT1048467	hsa-miR-4793-5p	CLIP-seq
MIRT1048468	hsa-miR-518a-5p	CLIP-seq
MIRT1048469	hsa-miR-527	CLIP-seq
MIRT2011021	hsa-miR-298	CLIP-seq
MIRT1048461	hsa-miR-320a	CLIP-seq
MIRT1048462	hsa-miR-320b	CLIP-seq
MIRT1048463	hsa-miR-320c	CLIP-seq
MIRT1048464	hsa-miR-320d	CLIP-seq
MIRT1048465	hsa-miR-320e	CLIP-seq
MIRT1048466	hsa-miR-4429	CLIP-seq
MIRT2011022	hsa-miR-4731-5p	CLIP-seq
MIRT2011023	hsa-miR-486-3p	CLIP-seq
MIRT1048468	hsa-miR-518a-5p	CLIP-seq
MIRT1048469	hsa-miR-527	CLIP-seq
MIRT2011021	hsa-miR-298	CLIP-seq
MIRT1048461	hsa-miR-320a	CLIP-seq
MIRT1048462	hsa-miR-320b	CLIP-seq
MIRT1048463	hsa-miR-320c	CLIP-seq
MIRT1048464	hsa-miR-320d	CLIP-seq
MIRT1048465	hsa-miR-320e	CLIP-seq
MIRT1048466	hsa-miR-4429	CLIP-seq
MIRT2243304	hsa-miR-4699-5p	CLIP-seq
MIRT2011022	hsa-miR-4731-5p	CLIP-seq
MIRT2011023	hsa-miR-486-3p	CLIP-seq
MIRT1048468	hsa-miR-518a-5p	CLIP-seq
MIRT1048469	hsa-miR-527	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Unknown	10886240
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002469	Process	Myeloid dendritic cell antigen processing and presentation	IDA	19531622, 30282837
GO:0002842	Process	Positive regulation of T cell mediated immune response to tumor cell	IDA	30282837
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005765	Component	Lysosomal membrane	IDA	18305173
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	19531622
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	6414998
GO:0007165	Process	Signal transduction	NAS	8775462
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	19531622, 32341563
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IDA	18305173
GO:0032395	Function	MHC class II receptor activity	NAS	6414998
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0042605	Function	Peptide antigen binding	IDA	17583734, 18697946
GO:0042605	Function	Peptide antigen binding	ISS	20356827
GO:0042613	Component	MHC class II protein complex	ISS	20356827
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0071556	Component	Integral component of lumenal side of endoplasmic reticulum membrane	TAS
GO:2000516	Process	Positive regulation of CD4-positive, alpha-beta T cell activation	IDA	19531622

Other IDs

• MIM: 612735
• HGNC: 4951
• e!Ensembl: HGNC

Protein

• UniProt ID: P79483
• Protein name: HLA class II histocompatibility antigen, DR beta 3 chain (MHC class II antigen DRB3)
• Protein function: A beta chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the alpha chain HLA-DRA, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T c
• PDB: 2Q6W, 3C5J, 4H1L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00969	MHC_II_beta	42 → 116	Class II histocompatibility antigen, beta domain	Domain
  PF07654	C1-set	128 → 209	Immunoglobulin C1-set domain	Domain

• Sequence:

  MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
  HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
  QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
  DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
  FLGAGLFIYFRNQKGHSGLQPTGFLS

• Sequence length: 266

Pathways

KEGG:

Phagosome
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
MHC class II antigen presentation
PD-1 signaling
Interferon gamma signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	30929738
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	28540026

Unknown
Disease name	Disease term	dbSNP ID	References
Development disorder	Child Development Disorders, Pervasive		28540026