HLA-DRA (major histocompatibility complex, class II, DR alpha)

Gene

• Entrez ID: 3122
• Gene name: Major histocompatibility complex, class II, DR alpha
• Gene symbol: HLA-DRA
• Synonyms: HLA-DRA1
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. This molecule is expressed on the surface of various antigen presenting cells such a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT401743	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT392159	hsa-miR-4496	PAR-CLIP	23592263
MIRT401741	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT401739	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT401744	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT487344	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT487343	hsa-miR-124-5p	PAR-CLIP	23592263
MIRT401738	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT401740	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT401745	hsa-miR-3915	PAR-CLIP	23592263
MIRT487342	hsa-miR-1224-5p	PAR-CLIP	23592263
MIRT487341	hsa-miR-4689	PAR-CLIP	23592263
MIRT487340	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT487339	hsa-miR-1304-5p	PAR-CLIP	23592263
MIRT401743	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT392159	hsa-miR-4496	PAR-CLIP	23592263
MIRT401741	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT401739	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT401744	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT487344	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT487343	hsa-miR-124-5p	PAR-CLIP	23592263
MIRT401738	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT401740	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT401745	hsa-miR-3915	PAR-CLIP	23592263
MIRT487342	hsa-miR-1224-5p	PAR-CLIP	23592263
MIRT487341	hsa-miR-4689	PAR-CLIP	23592263
MIRT487340	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT487339	hsa-miR-1304-5p	PAR-CLIP	23592263
MIRT1048447	hsa-miR-3148	CLIP-seq
MIRT1048448	hsa-miR-3158-3p	CLIP-seq
MIRT1048449	hsa-miR-3652	CLIP-seq
MIRT1048450	hsa-miR-4430	CLIP-seq
MIRT1048451	hsa-miR-4446-3p	CLIP-seq
MIRT1048452	hsa-miR-4492	CLIP-seq
MIRT1048453	hsa-miR-4498	CLIP-seq
MIRT1048454	hsa-miR-4699-5p	CLIP-seq
MIRT1048455	hsa-miR-4728-3p	CLIP-seq
MIRT1048456	hsa-miR-762	CLIP-seq
MIRT1048457	hsa-miR-875-3p	CLIP-seq
MIRT2682322	hsa-miR-298	CLIP-seq
MIRT2682323	hsa-miR-4422	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Activation	9600954
CIITA	Unknown	10886240;11429551;11889043;9300692
HDAC1	Repression	11533238
ILF3	Repression	10079079
ILF3	Unknown	7651394
POU2F2	Unknown	7629508
RFX1	Unknown	11889043
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423
YY1	Unknown	11533238;19252299

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001772	Component	Immunological synapse	IDA	15322540, 29884618
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	29884618
GO:0002250	Process	Adaptive immune response	IEA
GO:0002469	Process	Myeloid dendritic cell antigen processing and presentation	IDA	29884618
GO:0002491	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class II	IDA	15322540
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IDA	1448172, 7606781, 22733780
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IDA	21502329
GO:0005515	Function	Protein binding	IPI	9354468, 27114505
GO:0005764	Component	Lysosome	IDA	8890155
GO:0005765	Component	Lysosomal membrane	IDA	9075930, 18305173
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	8890155
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	6304715, 6812963
GO:0006955	Process	Immune response	NAS	6304715, 6812963
GO:0009986	Component	Cell surface	IDA	21502329
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016032	Process	Viral process	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	15265931
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030247	Function	Polysaccharide binding	IDA	21502329
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IDA	9075930, 18305173, 19117940
GO:0032395	Function	MHC class II receptor activity	NAS	6304715, 6812963
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IDA	28467828
GO:0042605	Function	Peptide antigen binding	IDA	1448172, 7477400, 7606781, 17583734, 18697946, 21502329, 22733780
GO:0042608	Function	T cell receptor binding	IDA	29884618
GO:0042613	Component	MHC class II protein complex	IDA	1448172, 7477400, 7606781, 21502329, 22733780
GO:0042613	Component	MHC class II protein complex	IMP	9354468
GO:0043382	Process	Positive regulation of memory T cell differentiation	IDA	27591323
GO:0045622	Process	Regulation of T-helper cell differentiation	IDA	15322540
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050890	Process	Cognition	IMP	23227193
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0070062	Component	Extracellular exosome	HDA	11487543, 12519789, 19056867, 19199708, 20458337
GO:0071556	Component	Integral component of lumenal side of endoplasmic reticulum membrane	TAS
GO:2000516	Process	Positive regulation of CD4-positive, alpha-beta T cell activation	IDA	15265931

Other IDs

• MIM: 142860
• HGNC: 4947
• e!Ensembl: ENSG00000204287

Protein

• UniProt ID: P01903
• Protein name: HLA class II histocompatibility antigen, DR alpha chain (MHC class II antigen DRA)
• Protein function: An alpha chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the beta chain HLA-DRB, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T
• PDB: 1A6A, 1AQD, 1BX2, 1D5M, 1D5X, 1D5Z, 1D6E, 1DLH, 1FV1, 1FYT, 1H15, 1HQR, 1HXY, 1J8H, 1JWM, 1JWS, 1JWU, 1KG0, 1KLG, 1KLU, 1LO5, 1PYW, 1R5I, 1SEB, 1SJE, 1SJH, 1T5W, 1T5X, 1YMM, 1ZGL, 2FSE, 2G9H, 2IAM, 2IAN, 2ICW, 2IPK, 2OJE, 2Q6W, 2SEB, 2WBJ, 2XN9, 3C5J, 3L6F, 3O6F, 3PDO, 3PGC, 3PGD, 3QXA, 3QXD, 3S4S, 3S5L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00993	MHC_II_alpha	29 → 108	Class II histocompatibility antigen, alpha domain	Domain
  PF07654	C1-set	114 → 195	Immunoglobulin C1-set domain	Domain

• Sequence:

  MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
  MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
  PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
  STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
  GLRKSNAAERRGPL

• Sequence length: 254

Pathways

KEGG:

Phagosome
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
MHC class II antigen presentation
PD-1 signaling
Interferon gamma signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	19430480, 17632545
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	17660530, 20598377, 17660530
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137
Non-obstructive azoospermia	Non-obstructive azoospermia	rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900	22541561
Parkinson disease	Parkinson Disease	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	20711177, 24511991
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	21156761, 17804836, 19503088
Sarcoidosis	Sarcoidosis	rs2076530	22952805, 26651848, 19165924

Unknown
Disease name	Disease term	dbSNP ID	References
Alopecia	Alopecia
Graham little piccardi lassueur syndrome	Graham Little Piccardi Lassueur syndrome, Graham Little-Piccardi-Lassueur syndrome
Hodgkin disease	Hodgkin Disease		24149102
Lichen planopilaris	Lichen planus follicularis
Lupus erythematosus	Lupus Erythematosus, Systemic		24871463, 18204446, 19838195
Perifollicular hyperkeratosis	Perifollicular hyperkeratosis
Biliary cirrhosis	Primary biliary cirrhosis		28425483, 28062665
Scleroderma	Systemic Scleroderma		21779181
Sjogren`s syndrome	Sjogren`s Syndrome		24097067
Toxic shock syndrome	Toxic Shock Syndrome		28771573
Ulcerative colitis	Ulcerative Colitis		28008999