ANXA13 (annexin A13)

Gene

• Entrez ID: 312
• Gene name: Annexin A13
• Gene symbol: ANXA13
• Synonyms: ANX13, ISA
• Chromosome: 8
• Chromosome location: 8q24.13
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet be

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT786408	hsa-miR-1	CLIP-seq
MIRT786409	hsa-miR-105	CLIP-seq
MIRT786410	hsa-miR-1227	CLIP-seq
MIRT786411	hsa-miR-206	CLIP-seq
MIRT786412	hsa-miR-3673	CLIP-seq
MIRT786413	hsa-miR-4484	CLIP-seq
MIRT786414	hsa-miR-455-5p	CLIP-seq
MIRT786415	hsa-miR-4799-5p	CLIP-seq
MIRT786416	hsa-miR-520d-5p	CLIP-seq
MIRT786417	hsa-miR-524-5p	CLIP-seq
MIRT786418	hsa-miR-613	CLIP-seq
MIRT786419	hsa-miR-885-5p	CLIP-seq
MIRT786420	hsa-miR-1252	CLIP-seq
MIRT786421	hsa-miR-3647-3p	CLIP-seq
MIRT786422	hsa-miR-4775	CLIP-seq
MIRT786423	hsa-miR-590-3p	CLIP-seq
MIRT2475342	hsa-miR-1827	CLIP-seq
MIRT2475343	hsa-miR-3609	CLIP-seq
MIRT2475344	hsa-miR-4709-3p	CLIP-seq
MIRT2475345	hsa-miR-548ah	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IDA	27676605
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005509	Function	Calcium ion binding	IDA	27676605
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	27676605
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	NAS	1530946
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019898	Component	Extrinsic component of membrane	IDA	27676605
GO:0030154	Process	Cell differentiation	NAS	1530946
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1901611	Function	Phosphatidylglycerol binding	IDA	27676605

Other IDs

• MIM: 602573
• HGNC: 536
• e!Ensembl: ENSG00000104537

Protein

• UniProt ID: P27216
• Protein name: Annexin A13 (Annexin XIII) (Annexin-13) (Intestine-specific annexin) (ISA)
• Protein function: [Isoform A]: Binds to membranes enriched in phosphatidylserine or phosphatidylglycerol in a calcium-dependent manner (PubMed:27676605, PubMed:30610115). Half-maximal membrane binding requires about 60 uM calcium. Does not bind to membranes that
• PDB: 6B3I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00191	Annexin	18 → 83	Annexin	Family
  PF00191	Annexin	90 → 155	Annexin	Family
  PF00191	Annexin	173 → 239	Annexin	Family
  PF00191	Annexin	249 → 314	Annexin	Family

• Sequence:

  MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATY
  GKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKE
  IIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD
  AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLV
  RCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVR
  SDTSGDFRKLLVALLH

• Sequence length: 316

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs10520699, rs11852999, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	29059683