HGFAC (HGF activator)

Gene

• Entrez ID: 3083
• Gene name: HGF activator
• Gene symbol: HGFAC
• Synonyms: HGFA
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: This gene encodes a member of the peptidase S1 protein family. The encoded protein is first synthesized as an inactive single-chain precursor before being activated to a heterodimeric form by endoproteolytic processing. It acts as serine protease that converts hepatocyte growth factor to the active form. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019046	hsa-miR-335-5p	Microarray	18185580
MIRT527732	hsa-miR-3611	PAR-CLIP	22012620
MIRT527732	hsa-miR-3611	PAR-CLIP	27292025
MIRT527733	hsa-miR-3185	PAR-CLIP	22012620
MIRT527734	hsa-miR-4311	PAR-CLIP	22012620
MIRT527734	hsa-miR-4311	PAR-CLIP	27292025
MIRT572581	hsa-miR-6739-3p	PAR-CLIP	20371350
MIRT572582	hsa-miR-4677-5p	PAR-CLIP	20371350
MIRT572583	hsa-miR-7156-5p	PAR-CLIP	20371350
MIRT572584	hsa-miR-4273	PAR-CLIP	20371350
MIRT572585	hsa-miR-3686	PAR-CLIP	20371350
MIRT572586	hsa-miR-3607-3p	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005791	Component	Rough endoplasmic reticulum	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0007596	Process	Blood coagulation	IBA	21873635
GO:0008236	Function	Serine-type peptidase activity	TAS	8226803
GO:0031638	Process	Zymogen activation	IBA	21873635

Other IDs

• MIM: 604552
• HGNC: 4894
• e!Ensembl: ENSG00000109758

Protein

• UniProt ID: Q04756
• Protein name: Hepatocyte growth factor activator (HGF activator) (HGFA) (EC 3.4.21.-) [Cleaved into: Hepatocyte growth factor activator short chain; Hepatocyte growth factor activator long chain]
• Protein function: Activates hepatocyte growth factor (HGF) by converting it from a single chain to a heterodimeric form.
• PDB: 1YBW, 1YC0, 2R0K, 2R0L, 2WUB, 2WUC, 3K2U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00040	fn2	108 → 148	Fibronectin type II domain	Domain
  PF00039	fn1	202 → 237	Fibronectin type I domain	Domain
  PF00008	EGF	245 → 277	EGF-like domain	Domain
  PF00051	Kringle	286 → 367	Kringle domain	Domain
  PF00089	Trypsin	408 → 641	Trypsin	Domain

• Sequence:

  MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
  TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
  ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
  PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
  RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
  SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
  YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
  WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
  KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
  GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
  PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS

• Sequence length: 655

Pathways

Reactome:

MET Receptor Activation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs-1, rs1989014468	26192919
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26192919
Cardiovascular diseases	Cardiovascular Diseases		30595370
Liver carcinoma	Liver carcinoma		19363144