KCNIP1 (potassium voltage-gated channel interacting protein 1)

Gene

• Entrez ID: 30820
• Gene name: Potassium voltage-gated channel interacting protein 1
• Gene symbol: KCNIP1
• Synonyms: KCHIP1, VABP
• Chromosome: 5
• Chromosome location: 5q35.1
• Summary: This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subun

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1081120	hsa-miR-3168	CLIP-seq
MIRT1081121	hsa-miR-4693-3p	CLIP-seq
MIRT1081122	hsa-miR-378g	CLIP-seq
MIRT1081123	hsa-miR-4437	CLIP-seq
MIRT1081124	hsa-miR-4674	CLIP-seq
MIRT2020107	hsa-miR-3123	CLIP-seq
MIRT2020108	hsa-miR-4302	CLIP-seq
MIRT2251921	hsa-miR-4436b-3p	CLIP-seq
MIRT2452194	hsa-miR-2467-3p	CLIP-seq
MIRT2452195	hsa-miR-3126-5p	CLIP-seq
MIRT2452196	hsa-miR-3649	CLIP-seq
MIRT2452197	hsa-miR-4503	CLIP-seq
MIRT2452198	hsa-miR-4720-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005244	Function	Voltage-gated ion channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	17187064
GO:0005515	Function	Protein binding	IPI	15358149, 17057713, 17187064
GO:0005737	Component	Cytoplasm	IDA	10676964
GO:0005886	Component	Plasma membrane	TAS
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	10676964, 17187064
GO:0015459	Function	Potassium channel regulator activity	IDA	10676964, 17187064
GO:0030425	Component	Dendrite	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	10676964
GO:0061337	Process	Cardiac conduction	TAS
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	10676964, 17187064

Other IDs

• MIM: 604660
• HGNC: 15521
• e!Ensembl: ENSG00000182132

Protein

• UniProt ID: Q9NZI2
• Protein name: A-type potassium channel modulatory protein KCNIP1 (Kv channel-interacting protein 1) (KChIP1) (Potassium channel-interacting protein 1) (Vesicle APC-binding protein)
• Protein function: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels (PubMed:10676964, PubMed:11423117, PubMed:17187064, PubMed:34552243, PubMed:34997220). Regulates channel density, inactivation kinetics and rate
• PDB: 1S1E, 2I2R, 2NZ0, 7E83, 7E84, 7F3F, 7W6N, 7W6T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13833	EF-hand_8	76 → 129	EF-hand domain pair	Domain
  PF13499	EF-hand_7	135 → 211	EF-hand domain pair	Domain
  PF13202	EF-hand_5	186 → 210	EF hand	Domain

• Sequence:

  MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
  KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
  DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
  TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM

• Sequence length: 227

Pathways

Reactome:

Phase 1 - inactivation of fast Na+ channels

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	27846195

Unknown
Disease name	Disease term	dbSNP ID	References
Cholangitis	Cholangitis, Sclerosing		28779025