GediPNet logo

HDAC2 (histone deacetylase 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3066
Gene nameGene Name - the full gene name approved by the HGNC.
Histone deacetylase 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
HDAC2
SynonymsGene synonyms aliases
HD2, KDAC2, RPD3, YAF1
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
SummarySummary of gene provided in NCBI Entrez Gene.
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007307 hsa-miR-145-5p Luciferase reporter assay 23499894
MIRT023724 hsa-miR-1-3p Proteomics 18668040
MIRT045549 hsa-miR-149-5p CLASH 23622248
MIRT437990 hsa-let-7f-5p qRT-PCR 24405266
MIRT437990 hsa-let-7f-5p qRT-PCR 24405266
Transcription factors
Transcription factor Regulation Reference
MYC Activation 20697349
MYCN Activation 20697349
RFX5 Unknown 16464847
YY1 Unknown 11532945
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IBA 21873635
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 19041327, 19276356
GO:0000785 Component Chromatin HDA 16217013
GO:0001103 Function RNA polymerase II repressing transcription factor binding IPI 22926524
GO:0001975 Process Response to amphetamine IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q92769
Protein name Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-)
Protein function Histone deacetylase that catalyzes the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (PubMed:28497810). Histone deacetylation gives a tag for epigenetic repression and plays an important role
PDB 3MAX , 4LXZ , 4LY1 , 5IWG , 5IX0 , 6G3O , 6WBW , 6WBZ , 6WHN , 6WHO , 6WHQ , 6WHZ , 6WI3 , 6XDM , 6XEB , 6XEC , 7JS8 , 7KBG , 7KBH , 7LTG , 7LTK , 7LTL , 7MOS , 7MOT , 7MOX , 7MOY , 7MOZ , 7ZZO , 7ZZP , 7ZZR , 7ZZS , 7ZZT , 7ZZU , 7ZZW , 8A0B , 8BPA , 8BPB , 8BPC , 8C60 , 9DTQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00850 Hist_deacetyl
29 320
Histone deacetylase domain
Domain
Sequence
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVA
LDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Sequence length 488
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  ATP-dependent chromatin remodeling
Polycomb repressive complex
Cell cycle
Longevity regulating pathway - multiple species
Notch signaling pathway
TGF-beta signaling pathway
Neutrophil extracellular trap formation
Thyroid hormone signaling pathway
Huntington disease
Amphetamine addiction
Alcoholism
Human papillomavirus infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Chronic myeloid leukemia
  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
HDACs deacetylate histones
Notch-HLH transcription pathway
SUMOylation of chromatin organization proteins
Regulation of TP53 Activity through Acetylation
RNA Polymerase I Transcription Initiation
Regulation of PTEN gene transcription
Regulation of MECP2 expression and activity
EGR2 and SOX10-mediated initiation of Schwann cell myelination
Factors involved in megakaryocyte development and platelet production
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 21527555
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928 15337792, 18421014
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050 22535842
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 22864611
Unknown
Disease name Disease term dbSNP ID References
Endometrioma Endometrioma 22138541
Endometriosis Endometriosis rs1800629, rs1143634 22138541
Liver cirrhosis Liver Cirrhosis 27396813
Liver fibrosis Fibrosis, Liver 27396813

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412