HCRTR1 (hypocretin receptor 1)

Gene

• Entrez ID: 3061
• Gene name: Hypocretin receptor 1
• Gene symbol: HCRTR1
• Synonyms: ORXR1, OX1R, OXR1
• Chromosome: 1
• Chromosome location: 1p35.2
• Summary: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor tha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018468	hsa-miR-335-5p	Microarray	18185580
MIRT1042241	hsa-miR-3124-3p	CLIP-seq
MIRT1042242	hsa-miR-3125	CLIP-seq
MIRT1042243	hsa-miR-3164	CLIP-seq
MIRT1042244	hsa-miR-3184	CLIP-seq
MIRT1042245	hsa-miR-3916	CLIP-seq
MIRT1042246	hsa-miR-423-5p	CLIP-seq
MIRT1042247	hsa-miR-511	CLIP-seq
MIRT1042248	hsa-miR-520a-5p	CLIP-seq
MIRT1042249	hsa-miR-525-5p	CLIP-seq
MIRT1042250	hsa-miR-587	CLIP-seq
MIRT1042251	hsa-miR-626	CLIP-seq
MIRT1042243	hsa-miR-3164	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	28717967
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	26950369
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IDA	26950369
GO:0007268	Process	Chemical synaptic transmission	TAS	9491897
GO:0007631	Process	Feeding behavior	IEA
GO:0016499	Function	Orexin receptor activity	IDA	26950369
GO:0017046	Function	Peptide hormone binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	26950369
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA

Other IDs

• MIM: 602392
• HGNC: 4848
• e!Ensembl: ENSG00000121764

Protein

• UniProt ID: O43613
• Protein name: Orexin/Hypocretin receptor type 1 (Hypocretin receptor type 1) (Orexin receptor type 1) (Ox-1-R) (Ox1-R) (Ox1R)
• Protein function: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide (PubMed:26950369, PubMed:9491897). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:26950369, Pu
• PDB: 4ZJ8, 4ZJC, 6TO7, 6TOD, 6TOS, 6TOT, 6TP3, 6TP4, 6TP6, 6TQ4, 6TQ6, 6TQ7, 6TQ9, 6V9S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	63 → 358	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
  LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
  VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
  AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
  KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
  MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
  LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
  TTVLP

• Sequence length: 425

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Orexin and neuropeptides FF and QRFP bind to their respective receptors
G alpha (q) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	15978554, 17999203

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	21377495, 22617356, 22617356, 21377495
Mood disorder	Mood Disorders		21071097