ANXA3 (annexin A3)

Gene

• Entrez ID: 306
• Gene name: Annexin A3
• Gene symbol: ANXA3
• Synonyms: ANX3
• Chromosome: 4
• Chromosome location: 4q21.21
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of pho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030154	hsa-miR-26b-5p	Microarray	19088304
MIRT786503	hsa-miR-1305	CLIP-seq
MIRT786504	hsa-miR-374c	CLIP-seq
MIRT786505	hsa-miR-655	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016, 2138632
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	17205602
GO:0005886	Component	Plasma membrane	IDA	7526843
GO:0006909	Process	Phagocytosis	IDA	9497492
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	16236264
GO:0016020	Component	Membrane	IDA	17205602
GO:0019834	Function	Phospholipase A2 inhibitor activity	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IDA	7526843
GO:0031100	Process	Animal organ regeneration	IEA
GO:0042581	Component	Specific granule	IDA	7526843
GO:0042742	Process	Defense response to bacterium	IDA	9497492
GO:0043025	Component	Neuronal cell body	IEA
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0043312	Process	Neutrophil degranulation	IDA	9550422
GO:0045766	Process	Positive regulation of angiogenesis	IDA	16236264
GO:0048306	Function	Calcium-dependent protein binding	IPI	15226301
GO:0051054	Process	Positive regulation of DNA metabolic process	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	16236264
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070848	Process	Response to growth factor	IEA

Other IDs

• MIM: 106490
• HGNC: 541
• e!Ensembl: ENSG00000138772

Protein

• UniProt ID: P12429
• Protein name: Annexin A3 (35-alpha calcimedin) (Annexin III) (Annexin-3) (Inositol 1,2-cyclic phosphate 2-phosphohydrolase) (Lipocortin III) (Placental anticoagulant protein III) (PAP-III)
• Protein function: Inhibitor of phospholipase A2, also possesses anti-coagulant properties. Also cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.
• PDB: 1AII, 1AXN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00191	Annexin	22 → 87	Annexin	Family
  PF00191	Annexin	94 → 159	Annexin	Family
  PF00191	Annexin	177 → 243	Annexin	Family
  PF00191	Annexin	253 → 318	Annexin	Family

• Sequence:

  MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
  QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR
  TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ
  ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
  LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
  SAIKSDTSGDYEITLLKICGGDD

• Sequence length: 323

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393	21435174
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	22446963

Unknown
Disease name	Disease term	dbSNP ID	References
Lupus erythematosus	Lupus Erythematosus, Systemic		22446963
Nonbacterial verrucal endocardiosis	Libman-Sacks Disease		22446963
Ovarian neoplasm	ovarian neoplasm		21435174
Prostatic neoplasms	Prostatic Neoplasms		17013881