HCK (HCK proto-oncogene, Src family tyrosine kinase)

Gene

• Entrez ID: 3055
• Gene name: HCK proto-oncogene, Src family tyrosine kinase
• Gene symbol: HCK
• Synonyms: AIPCV, JTK9, p59Hck, p61Hck
• Chromosome: 20
• Chromosome location: 20q11.21
• Summary: The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respirator

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1600755957	G>T	Likely-pathogenic	Stop gained, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1042041	hsa-miR-1245b-3p	CLIP-seq
MIRT1042042	hsa-miR-3654	CLIP-seq
MIRT1042043	hsa-miR-3915	CLIP-seq
MIRT1042044	hsa-miR-3928	CLIP-seq
MIRT1042045	hsa-miR-4318	CLIP-seq
MIRT1042046	hsa-miR-4496	CLIP-seq
MIRT1042047	hsa-miR-4520a-3p	CLIP-seq
MIRT1042048	hsa-miR-4638-3p	CLIP-seq
MIRT1042049	hsa-miR-4738-3p	CLIP-seq
MIRT1042050	hsa-miR-548g	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PML	Unknown	21993313
RARA	Unknown	21993313
SPI1	Unknown	21993313

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0002522	Process	Leukocyte migration involved in immune response	TAS	18538446
GO:0002758	Process	Innate immune response-activating signal transduction	TAS	18538446
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IMP	10092522
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7859737, 11278465, 11741929, 12029088, 14993658, 15784897, 16273093, 16374509, 16636290, 17141806, 18042718, 19234535, 20670214, 22641034, 22939624, 23397142, 24658140, 24728074, 24860872, 25036101, 25416956, 25469238, 25825872, 31980649, 32226298
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005764	Component	Lysosome	IDA	15998323
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IDA	15998323
GO:0005886	Component	Plasma membrane	IDA
GO:0005901	Component	Caveola	IDA	7791757
GO:0005925	Component	Focal adhesion	IMP	11904303
GO:0006468	Process	Protein phosphorylation	TAS	3496523
GO:0006954	Process	Inflammatory response	IEA
GO:0007155	Process	Cell adhesion	TAS	18538446
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	18538446
GO:0007498	Process	Mesoderm development	TAS	3453117
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	10092522
GO:0008360	Process	Regulation of cell shape	IMP	10092522, 11904303
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	10092522
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS	18538446
GO:0030133	Component	Transport vesicle	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030838	Process	Positive regulation of actin filament polymerization	TAS	18538446
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IMP	11904303
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	TAS	18538446
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17535448
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043299	Process	Leukocyte degranulation	TAS	18538446
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045728	Process	Respiratory burst after phagocytosis	TAS	18538446
GO:0046777	Process	Protein autophosphorylation	IMP	10092522
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0050727	Process	Regulation of inflammatory response	TAS	18538446
GO:0050764	Process	Regulation of phagocytosis	IMP	11904303
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	IMP	17535448
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS	18538446
GO:0071801	Process	Regulation of podosome assembly	IDA	15998323
GO:2000251	Process	Positive regulation of actin cytoskeleton reorganization	IDA	15998323
GO:2000251	Process	Positive regulation of actin cytoskeleton reorganization	IMP	11904303

Other IDs

• MIM: 142370
• HGNC: 4840
• e!Ensembl: ENSG00000101336

Protein

• UniProt ID: P08631
• Protein name: Tyrosine-protein kinase HCK (EC 2.7.10.2) (Hematopoietic cell kinase) (Hemopoietic cell kinase) (p59-HCK/p60-HCK) (p59Hck) (p61Hck)
• Protein function: Non-receptor tyrosine-protein kinase found in hematopoietic cells that transmits signals from cell surface receptors and plays an important role in the regulation of innate immune responses, including neutrophil, monocyte, macrophage and mast ce
• PDB: 1AD5, 1BU1, 1QCF, 2C0I, 2C0O, 2C0T, 2HCK, 2HK5, 2OI3, 2OJ2, 3HCK, 3NHN, 3RBB, 3REA, 3REB, 3VRY, 3VRZ, 3VS0, 3VS1, 3VS2, 3VS3, 3VS4, 3VS5, 3VS6, 3VS7, 4HCK, 4LUD, 4LUE, 4ORZ, 4U5W, 5H09, 5H0B, 5H0E, 5H0G, 5H0H, 5HCK, 5NUH, 5ZJ6, 8F2P, 9BYJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	84 → 130	SH3 domain	Domain
  PF00017	SH2	144 → 226	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	262 → 511	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
  PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
  ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
  SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
  CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
  AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
  FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
  IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
  NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP

• Sequence length: 526

Pathways

KEGG:

Chemokine signaling pathway
Fc gamma R-mediated phagocytosis
Kaposi sarcoma-associated herpesvirus infection

Reactome:

Nef and signal transduction
FCGR activation
Regulation of signaling by CBL
FCGR3A-mediated IL10 synthesis
FCGR3A-mediated phagocytosis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lymphoblastic leukemia	Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591	17344919

Unknown
Disease name	Disease term	dbSNP ID	References
Ovarian adenocarcinoma	Ovarian Mucinous Adenocarcinoma