NME7 (NME/NM23 family member 7)

Gene

• Entrez ID: 29922
• Gene name: NME/NM23 family member 7
• Gene symbol: NME7
• Synonyms: CFAP67, MN23H7, NDK 7, NDK7, nm23-H7
• Chromosome: 1
• Chromosome location: 1q24.2
• Summary: This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two k

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 21988832, 25416956, 26638075, 27107012, 27173435, 29892012, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	TAS
GO:0006165	Process	Nucleoside diphosphate phosphorylation	IEA
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 613465
• HGNC: 20461
• e!Ensembl: ENSG00000143156

Protein

• UniProt ID: Q9Y5B8
• Protein name: Nucleoside diphosphate kinase homolog 7 (NDK 7) (NDP kinase homolog 7) (3'-5' exonuclease NME7) (EC 3.1.-.-) (Protein kinase NME7) (EC 2.7.-.-) (nm23-H7)
• Protein function: Possesses an intrinsic kinase activity (PubMed:24807905). Displays 3'-5' exonuclease activity with a preference for single-stranded DNA (PubMed:16313181). Does not seem to have nucleoside diphosphate kinase activity (PubMed:16313181, PubMed:2480
• PDB: 7UNG, 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00334	NDK	92 → 226	Nucleoside diphosphate kinase	Domain
  PF00334	NDK	238 → 375	Nucleoside diphosphate kinase	Domain

• Sequence:

  MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDL
  FIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTI
  TKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPAN
  SGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCT
  CCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT
  EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLP
  EDGLLEVQYFFKILDN

• Sequence length: 376

Pathways

KEGG:

Purine metabolism
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism
Biosynthesis of cofactors

Reactome:

Recruitment of mitotic centrosome proteins and complexes
Recruitment of NuMA to mitotic centrosomes

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778
Gastrointestinal stromal tumor	Gastrointestinal Stromal Tumors, Gastrointestinal Stromal Sarcoma	rs587776653, rs74315368, rs74315369, rs587776793, rs587776794, rs587776795, rs606231209, rs121908589, rs121913685, rs121913680, rs794726675, rs587776804, rs121913517, rs121913234, rs121913512, rs267607032, rs387906780, rs201286421, rs587778661, rs587781270, rs587782243, rs74315370, rs587782703, rs786203457, rs764575966, rs786203251, rs587782604, rs200245469, rs397516836, rs786202732, rs786201161, rs786201063, rs751000085, rs869025568, rs876660642, rs876658713, rs151170408, rs878854632, rs752360961, rs121913235, rs121913521, rs121913513, rs1057519708, rs1057519710, rs121913514, rs1057519713, rs778582853, rs1060503757, rs1060502521, rs1060502543, rs898854295, rs981049067, rs916516745, rs1553887262, rs1057520032, rs1553887960, rs775143272, rs1560395607, rs1560418178, rs751904543, rs1560420761, rs1560417385, rs1560417396, rs1560417427, rs1560417438, rs1560417535, rs1560417642, rs1560417666, rs1560417673, rs1577992594, rs1577995761, rs1578003055, rs1301704156, rs1734957331	27793025
Situs inversus	Situs Inversus	rs528302390, rs1596264554	27060491