GSTA1 (glutathione S-transferase alpha 1)

Gene

• Entrez ID: 2938
• Gene name: Glutathione S-transferase alpha 1
• Gene symbol: GSTA1
• Synonyms: GST-epsilon, GST2, GSTA1-1, GTH1
• Chromosome: 6
• Chromosome location: 6p12.2
• Summary: This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in det

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029138	hsa-miR-26b-5p	Microarray	19088304
MIRT1036467	hsa-miR-4269	CLIP-seq
MIRT1036468	hsa-miR-4757-5p	CLIP-seq
MIRT1036469	hsa-miR-488	CLIP-seq
MIRT1036470	hsa-miR-513b	CLIP-seq
MIRT2007285	hsa-miR-23a	CLIP-seq
MIRT2007286	hsa-miR-23b	CLIP-seq
MIRT2007287	hsa-miR-23c	CLIP-seq
MIRT2007288	hsa-miR-3148	CLIP-seq
MIRT2007289	hsa-miR-3978	CLIP-seq
MIRT2007290	hsa-miR-432	CLIP-seq
MIRT2007291	hsa-miR-4427	CLIP-seq
MIRT2007292	hsa-miR-4452	CLIP-seq
MIRT2007293	hsa-miR-4680-3p	CLIP-seq
MIRT2239913	hsa-miR-519a	CLIP-seq
MIRT2239914	hsa-miR-519b-3p	CLIP-seq
MIRT2239915	hsa-miR-519c-3p	CLIP-seq
MIRT2007293	hsa-miR-4680-3p	CLIP-seq
MIRT2543451	hsa-miR-4724-5p	CLIP-seq
MIRT2007293	hsa-miR-4680-3p	CLIP-seq
MIRT2543451	hsa-miR-4724-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFE2L2	Activation	16551619
NFE2L2	Repression	22459801

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA	21873635
GO:0004364	Function	Glutathione transferase activity	IDA	9084911, 11851347, 20606271
GO:0004364	Function	Glutathione transferase activity	NAS	1731620
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0004769	Function	Steroid delta-isomerase activity	IDA	11152686
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006693	Process	Prostaglandin metabolic process	IDA	9084911
GO:0006749	Process	Glutathione metabolic process	IBA	21873635
GO:0006749	Process	Glutathione metabolic process	IDA	11851347, 20606271
GO:0006805	Process	Xenobiotic metabolic process	IBA	21873635
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1901687	Process	Glutathione derivative biosynthetic process	IDA	9084911
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS

Other IDs

• MIM: 138359
• HGNC: 4626
• e!Ensembl: ENSG00000243955

Protein

• UniProt ID: P08263
• Protein name: Glutathione S-transferase A1 (EC 2.5.1.18) (13-hydroperoxyoctadecadienoate peroxidase) (EC 1.11.1.-) (Androst-5-ene-3,17-dione isomerase) (EC 5.3.3.-) (GST HA subunit 1) (GST class-alpha member 1) (GST-epsilon) (GSTA1-1) (GTH1) [Cleaved into: Glutathione
• Protein function: Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates
• PDB: 1GSD, 1GSE, 1GSF, 1GUH, 1K3L, 1K3O, 1K3Y, 1LBK, 1PKW, 1PKZ, 1PL1, 1PL2, 1USB, 1XWG, 1YDK, 2R3X, 2R6K, 3I69, 3I6A, 3IK9, 3KTL, 3L0H, 3Q74, 3U6V, 3ZFB, 3ZFL, 4HJ2, 5JCU, 5LCZ, 5LD0, 6ATO, 6ATP, 6ATQ, 6ATR, 6YAW, 7BIB, 7BIC, 8BHC, 8BHE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	5 → 77	Glutathione S-transferase, N-terminal domain	Domain
  PF00043	GST_C	99 → 192	Glutathione S-transferase, C-terminal domain	Domain

• Sequence:

  MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
  DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
  LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
  LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF

• Sequence length: 222

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation
Heme degradation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	15616829
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	22959778, 21093063

Unknown
Disease name	Disease term	dbSNP ID	References
Kidney failure	Kidney Failure, Acute		28885000
Myocardial ischemia	Myocardial Ischemia		16214533
Non-alcoholic fatty liver disease	Non-alcoholic Fatty Liver Disease, Nonalcoholic Steatohepatitis		23643483
Prostatic neoplasms	Prostatic Neoplasms		15616829
Psychosis	Psychotic Disorders		22959778
Acute kidney insufficiency	Acute Kidney Insufficiency		28885000