GRPR (gastrin releasing peptide receptor)

Gene

• Entrez ID: 2925
• Gene name: Gastrin releasing peptide receptor
• Gene symbol: GRPR
• Synonyms: BB2, BB2R, BRS2
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050741	hsa-miR-17-3p	CLASH	23622248
MIRT1035462	hsa-miR-4421	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2239524	hsa-miR-129-5p	CLIP-seq
MIRT2239525	hsa-miR-1537	CLIP-seq
MIRT2239526	hsa-miR-3160-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239527	hsa-miR-4719	CLIP-seq
MIRT2239528	hsa-miR-513b	CLIP-seq
MIRT2239529	hsa-miR-520g	CLIP-seq
MIRT2239530	hsa-miR-520h	CLIP-seq
MIRT2239531	hsa-miR-548a-5p	CLIP-seq
MIRT2239532	hsa-miR-548aa	CLIP-seq
MIRT2239533	hsa-miR-548ab	CLIP-seq
MIRT2239534	hsa-miR-548ak	CLIP-seq
MIRT2239535	hsa-miR-548b-5p	CLIP-seq
MIRT2239536	hsa-miR-548c-5p	CLIP-seq
MIRT2239537	hsa-miR-548d-5p	CLIP-seq
MIRT2239538	hsa-miR-548h	CLIP-seq
MIRT2239539	hsa-miR-548i	CLIP-seq
MIRT2239540	hsa-miR-548j	CLIP-seq
MIRT2239541	hsa-miR-548w	CLIP-seq
MIRT2239542	hsa-miR-548y	CLIP-seq
MIRT2239543	hsa-miR-559	CLIP-seq
MIRT2239544	hsa-miR-607	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2450818	hsa-miR-3664-3p	CLIP-seq
MIRT2450819	hsa-miR-4433	CLIP-seq
MIRT2450820	hsa-miR-4459	CLIP-seq
MIRT2450821	hsa-miR-4493	CLIP-seq
MIRT2450822	hsa-miR-4768-3p	CLIP-seq
MIRT2450823	hsa-miR-510	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	18483184
ETS1	Activation	15300220

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IMP	1655761
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008188	Function	Neuropeptide receptor activity	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	1655761
GO:0035176	Process	Social behavior	ISS
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0043207	Process	Response to external biotic stimulus	IEA
GO:0061744	Process	Motor behavior	ISS

Other IDs

• MIM: 305670
• HGNC: 4609
• e!Ensembl: ENSG00000126010

Protein

• UniProt ID: P30550
• Protein name: Gastrin-releasing peptide receptor (GRP-R) (GRP-preferring bombesin receptor)
• Protein function: Receptor for gastrin-releasing peptide (GRP) (PubMed:1655761). Signals via association with G proteins that activate a phosphatidylinositol-calcium second messenger system, resulting in Akt phosphorylation. Contributes to the regulation of food
• PDB: 7W3Z, 7W40, 7W41, 8H0Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 323	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
  LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
  LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
  LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
  AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
  FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
  LKSTNPSVATFSLINGNICHERYV

• Sequence length: 384

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17204703

Unknown
Disease name	Disease term	dbSNP ID	References
Memory disorders	Memory Disorders		17097693
Age-related memory disorders	Age-Related Memory Disorders		17097693
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	21254899
Prostatic neoplasms	Prostatic Neoplasms		17204703