GRM7 (glutamate metabotropic receptor 7)

Gene

• Entrez ID: 2917
• Gene name: Glutamate metabotropic receptor 7
• Gene symbol: GRM7
• Synonyms: GLUR7, GPRC1G, MGLU7, MGLUR7, NEDSHBA, PPP1R87
• Chromosome: 3
• Chromosome location: 3p26.1
• Summary: L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be pert

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1114167298	T>C	Likely-pathogenic	Missense variant, upstream transcript variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs1114167300	C>T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1114167301	C>A,T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000073	hsa-miR-34a-5p	Review, qRT-PCR	20388499
MIRT000073	hsa-miR-34a-5p	Review, qRT-PCR	20388499
MIRT000073	hsa-miR-34a-5p	Reporter assay;Proteomics	21566225
MIRT1035267	hsa-miR-205	CLIP-seq
MIRT1035268	hsa-miR-3124-3p	CLIP-seq
MIRT1035269	hsa-miR-4668-3p	CLIP-seq
MIRT1035270	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001640	Function	Adenylate cyclase inhibiting G protein-coupled glutamate receptor activity	IBA	21873635
GO:0001642	Function	Group III metabotropic glutamate receptor activity	IBA	21873635
GO:0001642	Function	Group III metabotropic glutamate receptor activity	IDA	9144652, 9473604
GO:0001662	Process	Behavioral fear response	IMP	17167337
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	NAS	9473604
GO:0005938	Component	Cell cortex	IDA	9630572
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007196	Process	Adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IDA	9473604
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	IDA	9473604
GO:0007605	Process	Sensory perception of sound	IMP	19047183
GO:0008066	Function	Glutamate receptor activity	IDA	9473604
GO:0010855	Function	Adenylate cyclase inhibitor activity	IDA	9473604
GO:0014050	Process	Negative regulation of glutamate secretion	ISS
GO:0016021	Component	Integral component of membrane	IDA	12746871
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IDA	9630572
GO:0031279	Process	Regulation of cyclase activity	IEA
GO:0032279	Component	Asymmetric synapse	ISS
GO:0043198	Component	Dendritic shaft	ISS
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0048786	Component	Presynaptic active zone	ISS
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0070905	Function	Serine binding	IDA	9144652

Other IDs

• MIM: 604101
• HGNC: 4599
• e!Ensembl: ENSG00000196277

Protein

• UniProt ID: Q14831
• Protein name: Metabotropic glutamate receptor 7 (mGluR7)
• Protein function: G-protein coupled receptor activated by glutamate that regulates axon outgrowth through the MAPK-cAMP-PKA signaling pathway during neuronal development (PubMed:33500274). Ligand binding causes a conformation change that triggers signaling via gu
• PDB: 3MQ4, 5C5C, 7EPC, 7EPD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01094	ANF_receptor	77 → 486	Receptor family ligand binding region	Family
  PF07562	NCD3G	519 → 569	Nine Cysteines Domain of family 3 GPCR	Family
  PF00003	7tm_3	602 → 847	7 transmembrane sweet-taste receptor of 3 GCPR	Family

• Sequence:

  MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
  GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
  TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
  STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
  ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
  RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
  NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
  ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
  QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
  CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
  GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
  FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
  FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
  PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
  YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
  PAAKKKYVSYNNLVI

• Sequence length: 915

Pathways

KEGG:

Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Attention deficit hyperactivity disorder	Attention Deficit Disorder, Attention deficit hyperactivity disorder	rs120074176, rs786205019	22138692
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	24185611
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19638256, 19351574, 26254163, 18329248

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		16958029, 24804643, 20398908
Brain atrophy	Brain atrophy
Colorectal adenoma	Adenoma of large intestine		29228715
Hypoplasia of corpus callosum	Hypoplasia of corpus callosum
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	20038947, 22287544, 23059104, 20423346, 24596089, 23059104, 20423346, 24596089, 22287544, 20038947, 20398908, 21813496, 20038947, 20638442, 24278217, 24278217, 21813496, 20038947, 20638442, 20398908
Minimal brain dysfunction	Minimal Brain Dysfunction		22138692