GRIK5 (glutamate ionotropic receptor kainate type subunit 5)

Gene

• Entrez ID: 2901
• Gene name: Glutamate ionotropic receptor kainate type subunit 5
• Gene symbol: GRIK5
• Synonyms: EAA2, GRIK2, GluK5, KA2
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045128	hsa-miR-186-5p	CLASH	23622248
MIRT515221	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT515220	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT515221	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT515220	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT2006796	hsa-miR-3150a-3p	CLIP-seq
MIRT2006797	hsa-miR-3175	CLIP-seq
MIRT2006798	hsa-miR-4274	CLIP-seq
MIRT2006799	hsa-miR-4293	CLIP-seq
MIRT2006800	hsa-miR-4468	CLIP-seq
MIRT2006801	hsa-miR-939	CLIP-seq
MIRT2450777	hsa-miR-4632	CLIP-seq
MIRT2450778	hsa-miR-572	CLIP-seq
MIRT2450779	hsa-miR-718	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006621	Process	Protein retention in ER lumen	IEA
GO:0008066	Function	Glutamate receptor activity	IBA	21873635
GO:0015276	Function	Ligand-gated ion channel activity	IBA	21873635
GO:0015277	Function	Kainate selective glutamate receptor activity	IDA	1321949
GO:0017124	Function	SH3 domain binding	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA
GO:0032983	Component	Kainate selective glutamate receptor complex	IEA
GO:0034220	Process	Ion transmembrane transport	IEA
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA	21873635
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0042802	Function	Identical protein binding	IEA
GO:0043113	Process	Receptor clustering	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045211	Component	Postsynaptic membrane	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA	21873635
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:1904315	Function	Transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	21873635

Other IDs

• MIM: 600283
• HGNC: 4583
• e!Ensembl: ENSG00000105737

Protein

• UniProt ID: Q16478
• Protein name: Glutamate receptor ionotropic, kainate 5 (GluK5) (Excitatory amino acid receptor 2) (EAA2) (Glutamate receptor KA-2) (KA2)
• Protein function: Ionotropic glutamate receptor that functions as a cation-permeable ligand-gated ion channel, gated by L-glutamate and the glutamatergic agonist kainic acid. Cannot form functional channels on its own and produces channel activity only in heterom
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01094	ANF_receptor	39 → 384	Receptor family ligand binding region	Family
  PF10613	Lig_chan-Glu_bd	415 → 529	Ligated ion channel L-glutamate- and glycine-binding site	Domain
  PF00060	Lig_chan	543 → 815	Ligand-gated ion channel	Family

• Sequence:

  MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
  ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
  GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
  FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
  KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
  ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
  RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
  TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
  WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
  PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
  GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
  QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
  LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
  KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
  VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
  SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
  TSPPRPRPGPAGPRELAEHE

• Sequence length: 980

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Glutamatergic synapse

Reactome:

Activation of Ca-permeable Kainate Receptor

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	18923069

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		19086053