Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
28999 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
KLF transcription factor 15 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
KLF15 |
SynonymsGene synonyms aliases
|
KKLF |
ChromosomeChromosome number
|
3 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
3q21.3 |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q9UIH9 |
Protein name |
Krueppel-like factor 15 (Kidney-enriched krueppel-like factor) |
Protein function |
Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of car |
PDB |
2ENT
|
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF00096 |
zf-C2H2 |
321 → 345 |
Zinc finger, C2H2 type |
Domain |
PF00096 |
zf-C2H2 |
351 → 375 |
Zinc finger, C2H2 type |
Domain |
PF00096 |
zf-C2H2 |
381 → 403 |
Zinc finger, C2H2 type |
Domain |
|
Sequence |
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW RFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN
|
|
Sequence length |
416 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Prostate cancer |
Malignant neoplasm of prostate |
rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 |
17013881 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Alopecia |
Alopecia |
|
28196072 |
Alopecia, male pattern |
Alopecia, Male Pattern |
|
29146897 |
Androgenetic alopecia |
Androgenetic Alopecia, Alopecia, Androgenetic, 3, Alopecia, Androgenetic, 2, Alopecia, Androgenetic, 1 |
|
29146897 |
Prostatic neoplasms |
Prostatic Neoplasms |
|
17013881 |
|