GPR37 (G protein-coupled receptor 37)

Gene

• Entrez ID: 2861
• Gene name: G protein-coupled receptor 37
• Gene symbol: GPR37
• Synonyms: EDNRBL, PAELR, hET(B)R-LP
• Chromosome: 7
• Chromosome location: 7q31.33
• Summary: This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018084	hsa-miR-335-5p	Microarray	18185580
MIRT024744	hsa-miR-215-5p	Microarray	19074876
MIRT026544	hsa-miR-192-5p	Microarray	19074876
MIRT027626	hsa-miR-98-5p	Microarray	19088304
MIRT733478	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT2005934	hsa-miR-3691-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	12150907
GO:0004930	Function	G protein-coupled receptor activity	TAS	9144577
GO:0005515	Function	Protein binding	IPI	14532270, 17519329, 28298427, 32814053
GO:0005737	Component	Cytoplasm	IDA	16443751
GO:0005783	Component	Endoplasmic reticulum	IDA	17059562
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	11439185, 12150907
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9144577
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	23690594
GO:0007218	Process	Neuropeptide signaling pathway	IDA	16443751
GO:0008188	Function	Neuropeptide receptor activity	IDA	16443751
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	23690594
GO:0009986	Component	Cell surface	IDA	16443751
GO:0030544	Function	Hsp70 protein binding	IPI	12150907
GO:0031072	Function	Heat shock protein binding	IPI	12150907
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11439185, 12150907, 17059562
GO:0031987	Process	Locomotion involved in locomotory behavior	IEA
GO:0036505	Function	Prosaposin receptor activity	IBA	21873635
GO:0036505	Function	Prosaposin receptor activity	IDA	23690594
GO:0042277	Function	Peptide binding	IPI	23690594
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042923	Function	Neuropeptide binding	IPI	16443751
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043410	Process	Positive regulation of MAPK cascade	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23690594
GO:0045964	Process	Positive regulation of dopamine metabolic process	IEA
GO:1903206	Process	Negative regulation of hydrogen peroxide-induced cell death	ISS	23690594

Other IDs

• MIM: 602583
• HGNC: 4494
• e!Ensembl: ENSG00000170775

Protein

• UniProt ID: O15354
• Protein name: Prosaposin receptor GPR37 (Endothelin B receptor-like protein 1) (ETBR-LP-1) (G-protein coupled receptor 37) (Parkin-associated endothelin receptor-like receptor) (PAELR)
• Protein function: G-protein-coupled receptor that plays a role in several physiological pathways such as resolution of inflammatory pain and oligodendrocyte differentiation (By similarity). Acts as a receptor for several ligands including prosaposin, osteocalcin
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	278 → 549	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
  NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
  RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
  YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
  TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
  ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
  RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
  IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
  KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
  KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
  REMSTFASVGTHC

• Sequence length: 613

Pathways

KEGG:

Parkinson disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Melanoma	Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	26237428

Unknown
Disease name	Disease term	dbSNP ID	References
Lymphocytic leukemia	Chronic Lymphocytic Leukemia, Small Lymphocytic Lymphoma		28165464
Malignant melanoma of skin	Malignant melanoma of skin of lower limb, Malignant melanoma of skin of upper limb	rs16891982	26237428
Malignant mesothelioma	Malignant mesothelioma		25756049