PNPLA1 (patatin like domain 1, omega-hydroxyceramide transacylase)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
285848 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Patatin like domain 1, omega-hydroxyceramide transacylase |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
PNPLA1 |
SynonymsGene synonyms aliases
|
ARCI10, dJ50J22.1 |
ChromosomeChromosome number
|
6 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
6p21.31 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
The protein encoded by this gene belongs to the patatin-like phospholipase (PNPLA) family, which is characterized by the presence of a highly conserved patatin domain. PNPLA family members have diverse lipolytic and acyltransferase activities, and are key |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs140585347 |
C>T |
Conflicting-interpretations-of-pathogenicity |
Missense variant, upstream transcript variant, coding sequence variant, genic upstream transcript variant |
rs200806519 |
C>A,T |
Pathogenic |
Genic upstream transcript variant, coding sequence variant, upstream transcript variant, synonymous variant, missense variant |
rs369445146 |
C>A |
Pathogenic, likely-pathogenic |
Genic upstream transcript variant, missense variant, coding sequence variant, upstream transcript variant |
rs371307766 |
C>G,T |
Likely-pathogenic |
Genic upstream transcript variant, missense variant, coding sequence variant, upstream transcript variant |
rs373148099 |
G>A |
Pathogenic |
Missense variant, coding sequence variant, 5 prime UTR variant |
rs376245108 |
C>A,T |
Pathogenic |
Missense variant, coding sequence variant |
rs533584507 |
C>A,T |
Likely-pathogenic |
Missense variant, coding sequence variant, intron variant, genic upstream transcript variant |
rs746575171 |
G>A,C |
Likely-pathogenic |
Missense variant, coding sequence variant |
rs753687060 |
G>- |
Pathogenic |
Coding sequence variant, frameshift variant |
rs766188849 |
C>T |
Pathogenic |
5 prime UTR variant, coding sequence variant, missense variant |
rs766215523 |
C>T |
Likely-pathogenic |
Coding sequence variant, missense variant |
rs767462752 |
->GTACGAGGATGCAGTTTTGT |
Likely-pathogenic |
Coding sequence variant, frameshift variant |
rs781053760 |
T>C |
Pathogenic-likely-pathogenic, pathogenic |
Genic upstream transcript variant, missense variant, coding sequence variant, upstream transcript variant |
rs922934422 |
C>T |
Likely-pathogenic |
Upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant |
rs938583000 |
C>- |
Likely-pathogenic |
Coding sequence variant, intron variant, genic upstream transcript variant, frameshift variant |
rs1170446813 |
C>- |
Likely-pathogenic |
Coding sequence variant, frameshift variant |
rs1182312612 |
G>A,C |
Pathogenic |
Coding sequence variant, intron variant, genic upstream transcript variant, missense variant |
rs1207879599 |
C>G,T |
Pathogenic |
Genic upstream transcript variant, coding sequence variant, missense variant, intron variant |
rs1231123861 |
C>A,T |
Pathogenic |
Coding sequence variant, intron variant, missense variant, genic upstream transcript variant |
rs1373230987 |
C>G,T |
Likely-pathogenic |
Coding sequence variant, missense variant, genic upstream transcript variant, intron variant |
rs1407871103 |
A>C,G |
Pathogenic |
Upstream transcript variant, coding sequence variant, genic upstream transcript variant, missense variant |
rs1554138062 |
T>C |
Likely-pathogenic, pathogenic |
Missense variant, coding sequence variant |
rs1554139129 |
->GTCA |
Pathogenic |
Coding sequence variant, frameshift variant |
rs1561853847 |
C>T |
Pathogenic |
Genic upstream transcript variant, missense variant, coding sequence variant, intron variant |
rs1561864453 |
G>T |
Pathogenic |
Upstream transcript variant, coding sequence variant, stop gained, genic upstream transcript variant |
rs1582046125 |
T>C |
Pathogenic |
Genic upstream transcript variant, missense variant, coding sequence variant, intron variant |
rs1582078740 |
A>G |
Pathogenic |
Genic upstream transcript variant, upstream transcript variant, coding sequence variant, missense variant |
rs1582081682 |
T>C |
Pathogenic |
Missense variant, coding sequence variant, 5 prime UTR variant |
rs1582086407 |
TAC>- |
Pathogenic |
Coding sequence variant, inframe deletion |
|
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8N8W4 |
Protein name |
Omega-hydroxyceramide transacylase (EC 2.3.1.296) (Patatin-like phospholipase domain-containing protein 1) |
Protein function |
Omega-hydroxyceramide transacylase involved in the synthesis of omega-O-acylceramides (esterified omega-hydroxyacyl-sphingosine; EOS), which are extremely hydrophobic lipids involved in skin barrier formation (PubMed:27751867, PubMed:28248318). |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF01734 |
Patatin |
16 → 84 |
Patatin-like phospholipase |
Family |
|
Sequence |
MEEQVFKGDPDTPHSISFSGSGFLSFYQAGAVDALRDLAPRMLETAHRFAGTSAGAVIAA LAICGIEMDEYLRVLNVGVAEVKKSFLGPLSPSCKMVQMMRQFLYRVLPEDSYKVTTGKL HVSLTRLTDGENVVVSEFTSKEELIEALYCSCFVPVYCGLIPPTYRGVRYIDGGFTGMQP CAFWTDAITISTFSGQQDICPRDCPAIFHDFRMFNCSFQFSLENIARMTHALFPPDLVIL HDYYYRGYEDAVLYLRRLNAVYLNSSSKRVIFPRVEVYCQIELALGNECPERSQPSLRAR QASLEGATQPHKEWVPKGDGRGSHGPPVSQPVQTLEFTCESPVSAPVSPLEQPPAQPLAS STPLSLSGMPPVSFPAVHKPPSSTPGSSLPTPPPGLSPLSPQQQVQPSGSPARSLHSQAP TSPRPSLGPSTVGAPQTLPRSSLSAFPAQPPVEELGQEQPQAVALLVSSKPKSAVPLVHV KETVSKPYVTESPAEDSNWVNKVFKKNKQKTSGTRKGFPRHSGSKKPSSKVQ
|
|
Sequence length |
532 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Congenital ichthyosis |
Congenital ichthyosis |
rs118203935, rs118203936, rs118203937, rs199422216, rs199422217, rs1561831582, rs28940268, rs28940269, rs28940568, rs28940270, rs387906284, rs387906285, rs137853289, rs267606622, rs121434232, rs121434233, rs121434234, rs137852931, rs137852932, rs137853131, rs387906349, rs137853023, rs137853024, rs2139023508, rs121918719, rs121918728, rs121918716, rs121918717, rs121918718, rs121918720, rs121918721, rs121918722, rs121918723, rs2139018490, rs121918725, rs121918726, rs121918727, rs121918730, rs121918731, rs121918732, rs398122900, rs397514522, rs398122901, rs878853259, rs397514523, rs397514524, rs397514525, rs143473912, rs398122902, rs398122903, rs398122904, rs398122905, rs397514526, rs397514527, rs397514528, rs397514529, rs1598181810, rs397514532, rs199766569, rs397514533, rs786205120, rs745480657, rs1355284797, rs1561864453, rs1561853847, rs587776996, rs762679102, rs141340759, rs587777262, rs587777263, rs199545653, rs863223405, rs370031870, rs864321707, rs753798494, rs114863111, rs11891778, rs780990272, rs886039654, rs752509098, rs750066836, rs142634031, rs886041250, rs886041950, rs200491579, rs147149459, rs531800013, rs781006633, rs370356566, rs201868387, rs1057517836, rs904122716, rs151054393, rs531650682, rs139208806, rs959284348, rs1170446813, rs781053760, rs369445146, rs922934422, rs202128350, rs745368359, rs139375856, rs199503269, rs1064794422, rs367699137, rs762667660, rs1114167426, rs1114167425, rs1114167424, rs762765702, rs1131692156, rs1555643304, rs775524204, rs1554138062, rs771820315, rs1555306238, rs760429286, rs1553520468, rs774363396, rs1555305836, rs1220151696, rs1555306172, rs140000324, rs752349623, rs1555305725, rs1555305783, rs1555306113, rs779287673, rs1437822062, rs776068111, rs1555306117, rs1322979131, rs199678720, rs1211601030, rs147916609, rs1156392436, rs773303931, rs1044429462, rs1555306089, rs1555306102, rs1296165092, rs1199770893, rs972054392, rs201432046, rs758568142, rs118091316, rs369811073, rs1568357749, rs773886415, rs1382435790, rs770500550, rs776275777, rs1568360348, rs1568360387, rs1568360475, rs1568360526, rs1568360554, rs1568361250, rs751937099, rs768098854, rs767352854, rs755885838, rs370734976, rs1568362605, rs1568362644, rs769229606, rs201129618, rs1568364101, rs1568364107, rs1568364117, rs200581968, rs144961059, rs1568365205, rs1167473603, rs1360295659, rs1187032187, rs1559120651, rs200806519, rs1566380103, rs1182312612, rs761068277, rs764355087, rs1559134341, rs1561831443, rs373501601, rs1373230987, rs533584507, rs1582086407, rs746575171, rs538068583, rs1566377068, rs1202280089, rs1381998109, rs543521135, rs1247223599, rs773777400, rs1230140208, rs1566381457, rs1567644030, rs1567980596, rs746723399, rs1028050037, rs1567985231, rs1567985261, rs1311967606, rs1296095311, rs765682032, rs1568005543, rs1449980834, rs745942843, rs112419023, rs1566378425, rs1581262988, rs1581265561, rs775903553, rs900769357, rs371608909, rs777992589, rs1581271869, rs1581272003, rs1212378071, rs1027052344, rs375688767, rs1581272834, rs886060339, rs1581273254, rs1452328130, rs1581269752, rs1581271844, rs1207879599, rs1582078740, rs766188849, rs753687060, rs1594571148, rs1598181642, rs1574984736, rs1596772428, rs867950920, rs1594568541, rs760428119 |
|
Ichthyosis |
Ichthyoses |
rs199766569, rs587776996, rs587777262, rs863223405, rs370031870, rs1569044747, rs200806519 |
22246504 |
Ichthyosis with hypotrichosis |
ICHTHYOSIS, CONGENITAL, AUTOSOMAL RECESSIVE 10 |
rs1114167426, rs1114167425, rs1114167424, rs762765702, rs530109812, rs774363396, rs760309815, rs140526640, rs1303127476 |
26778108, 22246504, 28369476 |
Keratitis |
Keratitis |
rs587776571 |
|
Palmoplantar keratoderma |
Keratoderma, Palmoplantar |
rs59616921, rs1568039793, rs746488412, rs200564757, rs1567027297, rs781596375, rs1567027610, rs398123054, rs398123055, rs398123056, rs398123057, rs398122949, rs398122950, rs397515639, rs398122951, rs397515640, rs397515641, rs142859678, rs797044479, rs577442939, rs672601344, rs568609861, rs1057518846, rs1182196436, rs1567037561 |
|
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Alopecia |
Alopecia |
|
|
Congenital nonbullous ichthyosiform erythroderma |
Congenital Nonbullous Ichthyosiform Erythroderma, Congenital non-bullous ichthyosiform erythroderma |
|
22246504 |
Corneal erosion |
Corneal erosion |
|
|
Dwarfism |
Dwarfism |
|
|
Ectropion |
Ectropion |
|
|
Exfoliative dermatitis |
Exfoliative dermatitis |
|
|
Hypohidrosis |
Hypohidrosis |
|
|
Ichthyosis congenita |
Ichthyosiform Erythroderma, Congenital |
|
28403545 |
Xeroderma |
Xeroderma |
|
22246504 |
|
|
|