GediPNet logo

PIGW (phosphatidylinositol glycan anchor biosynthesis class W)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
284098
Gene nameGene Name - the full gene name approved by the HGNC.
Phosphatidylinositol glycan anchor biosynthesis class W
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
PIGW
SynonymsGene synonyms aliases
Gwt1, HPMRS5
ChromosomeChromosome number
17
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an inositol acyltransferase that acylates the inositol ring of phosphatidylinositol. This occurs in the endoplasmic reticulum and is a step in the biosynthesis of glycosylphosphatidylinositol (GPI), which anchors many c
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs147622852 C>T Likely-pathogenic Stop gained, coding sequence variant
rs200024253 A>G Pathogenic Missense variant, coding sequence variant
rs753385776 TTTG>- Likely-pathogenic Coding sequence variant, frameshift variant
rs1256773607 A>G Pathogenic Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT547112 hsa-miR-200a-3p PAR-CLIP 21572407
MIRT547111 hsa-miR-141-3p PAR-CLIP 21572407
MIRT286845 hsa-miR-374b-5p PAR-CLIP 21572407
MIRT286843 hsa-miR-374a-5p PAR-CLIP 21572407
MIRT286847 hsa-miR-5583-3p PAR-CLIP 21572407
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006505 Process GPI anchor metabolic process IC 24367057
GO:0006506 Process GPI anchor biosynthetic process IBA 21873635
GO:0008374 Function O-acyltransferase activity TAS
GO:0016021 Component Integral component of membrane IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q7Z7B1
Protein name Glucosaminyl-phosphatidylinositol-acyltransferase PIGW (GlcN-PI-acyltransferase) (EC 2.3.-.-) (Phosphatidylinositol-glycan biosynthesis class W protein) (PIG-W)
Protein function Acyltransferase that catalyzes the acyl transfer from an acyl-CoA at the 2-OH position of the inositol ring of glucosaminyl phosphatidylinositol (GlcN-PI) to generate glucosaminyl acyl phosphatidylinositol (GlcN-(acyl)PI) and participates in the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06423 GWT1
301 463
GWT1
Family
Sequence
MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLTD
FVVLIVPMVATLTIWASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFLKILEKFLNIS
LESEYNPAISCFRVITSAFTAIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGSAM
VCLEVRRRKYMEGSKLHYFTNSLYSVWPLVFLGIGRLAIIKSIGYQEHLTEYGVHWNFFF
TIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLN
ANREGIISTLGYVAIHMAGVQTGLYMHKNRSHIKDLIKVACFLLLAAISLFISLYVVQVN
VEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTN
KKHSESLVPEAERMEPSLCLITALNRKQLIFFLLSNITTGLIN
LMVDTLHSSTLWALFVV
NLYMFSNCLIVYVLYLQDKTVQFW
Sequence length 504
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
  Synthesis of glycosylphosphatidylinositol (GPI)
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Autism Autistic behavior rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Glycosylphosphatidylinositol deficiency Glycosylphosphatidylinositol deficiency, GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 11 rs1010907740, rs1554764080, rs1554764067, rs782768127, rs782220208, rs1553259614, rs1553259602, rs782615259, rs761543313, rs776038451, rs1263517814, rs1567618413, rs1567614073, rs1426262136, rs1567616570, rs1554763770, rs1600656141, rs756912205 27626616, 30078644, 24367057
Hirschsprung disease Hirschsprung Disease rs104893891, rs76262710, rs75075748, rs75996173, rs79014735, rs77316810, rs75076352, rs76087194, rs76534745, rs76764689, rs76449634, rs78098482, rs79661516, rs104894389, rs769735757, rs267606780, rs1568823467, rs377767412, rs193922699, rs75030001, rs606231342, rs1553540620, rs759944122, rs1057519322, rs1057519323, rs1057519052, rs1588873476, rs1588866040, rs1838178869
Unknown
Disease name Disease term dbSNP ID References
Accessory nipple Accessory nipple
Brachycephaly Brachycephaly
Clinodactyly Clinodactyly of fingers, Clinodactyly
Congenital epicanthus Congenital Epicanthus

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412