ANGPT1 (angiopoietin 1)

Gene

• Entrez ID: 284
• Gene name: Angiopoietin 1
• Gene symbol: ANGPT1
• Synonyms: AGP1, AGPT, AGPT-1, ANG1, HAE5
• Chromosome: 8
• Chromosome location: 8q23.1
• Summary: This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT781397	hsa-miR-1253	CLIP-seq
MIRT781398	hsa-miR-3074-3p	CLIP-seq
MIRT781399	hsa-miR-3161	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT781401	hsa-miR-3919	CLIP-seq
MIRT781402	hsa-miR-4328	CLIP-seq
MIRT781403	hsa-miR-4705	CLIP-seq
MIRT781404	hsa-miR-526b	CLIP-seq
MIRT781397	hsa-miR-1253	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT781407	hsa-miR-181a	CLIP-seq
MIRT781408	hsa-miR-181b	CLIP-seq
MIRT781409	hsa-miR-181c	CLIP-seq
MIRT781410	hsa-miR-181d	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT781412	hsa-miR-3154	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT781415	hsa-miR-3682-3p	CLIP-seq
MIRT781416	hsa-miR-4262	CLIP-seq
MIRT781417	hsa-miR-4428	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT781419	hsa-miR-4716-5p	CLIP-seq
MIRT781420	hsa-miR-4738-3p	CLIP-seq
MIRT781421	hsa-miR-4774-5p	CLIP-seq
MIRT781422	hsa-miR-570	CLIP-seq
MIRT781423	hsa-miR-580	CLIP-seq
MIRT781424	hsa-miR-582-3p	CLIP-seq
MIRT781425	hsa-miR-603	CLIP-seq
MIRT2441939	hsa-miR-204	CLIP-seq
MIRT2441940	hsa-miR-211	CLIP-seq
MIRT2441941	hsa-miR-214	CLIP-seq
MIRT2441942	hsa-miR-3619-5p	CLIP-seq
MIRT2441943	hsa-miR-4291	CLIP-seq
MIRT2441944	hsa-miR-4659a-3p	CLIP-seq
MIRT2441945	hsa-miR-4659b-3p	CLIP-seq
MIRT2441946	hsa-miR-4755-5p	CLIP-seq
MIRT2441947	hsa-miR-623	CLIP-seq
MIRT2441948	hsa-miR-761	CLIP-seq
MIRT2441949	hsa-miR-922	CLIP-seq
MIRT2473895	hsa-miR-1243	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT2473896	hsa-miR-23a	CLIP-seq
MIRT2473897	hsa-miR-23b	CLIP-seq
MIRT2473898	hsa-miR-23c	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT2473899	hsa-miR-3143	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT2473900	hsa-miR-3164	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT2473901	hsa-miR-337-5p	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT2473902	hsa-miR-3611	CLIP-seq
MIRT2473903	hsa-miR-3654	CLIP-seq
MIRT2473904	hsa-miR-371-5p	CLIP-seq
MIRT2473905	hsa-miR-4257	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT2473906	hsa-miR-4680-5p	CLIP-seq
MIRT2473907	hsa-miR-4695-5p	CLIP-seq
MIRT2473908	hsa-miR-4712-3p	CLIP-seq
MIRT2473909	hsa-miR-4753-3p	CLIP-seq
MIRT2473910	hsa-miR-4766-5p	CLIP-seq
MIRT2473911	hsa-miR-4789-3p	CLIP-seq
MIRT2473912	hsa-miR-4799-5p	CLIP-seq
MIRT2473913	hsa-miR-513a-3p	CLIP-seq
MIRT2473914	hsa-miR-543	CLIP-seq
MIRT2473915	hsa-miR-548b-3p	CLIP-seq
MIRT2473916	hsa-miR-548l	CLIP-seq
MIRT2473917	hsa-miR-548n	CLIP-seq
MIRT2473918	hsa-miR-548u	CLIP-seq
MIRT2473919	hsa-miR-581	CLIP-seq
MIRT2473920	hsa-miR-593	CLIP-seq
MIRT2473921	hsa-miR-606	CLIP-seq
MIRT2473922	hsa-miR-617	CLIP-seq
MIRT2473923	hsa-miR-642b	CLIP-seq
MIRT2473924	hsa-miR-885-5p	CLIP-seq
MIRT2473925	hsa-miR-888	CLIP-seq
MIRT2473895	hsa-miR-1243	CLIP-seq
MIRT2674983	hsa-miR-1257	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT2674984	hsa-miR-1305	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT2674985	hsa-miR-144	CLIP-seq
MIRT2674986	hsa-miR-19a	CLIP-seq
MIRT2674987	hsa-miR-19b	CLIP-seq
MIRT2473896	hsa-miR-23a	CLIP-seq
MIRT2473897	hsa-miR-23b	CLIP-seq
MIRT2473898	hsa-miR-23c	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT2473899	hsa-miR-3143	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT2473900	hsa-miR-3164	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT2473901	hsa-miR-337-5p	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT2473902	hsa-miR-3611	CLIP-seq
MIRT2473903	hsa-miR-3654	CLIP-seq
MIRT2473904	hsa-miR-371-5p	CLIP-seq
MIRT2674988	hsa-miR-3977	CLIP-seq
MIRT2473905	hsa-miR-4257	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT2674989	hsa-miR-4670-3p	CLIP-seq
MIRT2473906	hsa-miR-4680-5p	CLIP-seq
MIRT2473907	hsa-miR-4695-5p	CLIP-seq
MIRT2674990	hsa-miR-4698	CLIP-seq
MIRT2674991	hsa-miR-4709-5p	CLIP-seq
MIRT2473908	hsa-miR-4712-3p	CLIP-seq
MIRT2473909	hsa-miR-4753-3p	CLIP-seq
MIRT2473910	hsa-miR-4766-5p	CLIP-seq
MIRT2473911	hsa-miR-4789-3p	CLIP-seq
MIRT2473912	hsa-miR-4799-5p	CLIP-seq
MIRT2473913	hsa-miR-513a-3p	CLIP-seq
MIRT2473914	hsa-miR-543	CLIP-seq
MIRT2473915	hsa-miR-548b-3p	CLIP-seq
MIRT2473916	hsa-miR-548l	CLIP-seq
MIRT2473917	hsa-miR-548n	CLIP-seq
MIRT2473918	hsa-miR-548u	CLIP-seq
MIRT2473919	hsa-miR-581	CLIP-seq
MIRT2473920	hsa-miR-593	CLIP-seq
MIRT2473921	hsa-miR-606	CLIP-seq
MIRT2674992	hsa-miR-607	CLIP-seq
MIRT2473922	hsa-miR-617	CLIP-seq
MIRT2473923	hsa-miR-642b	CLIP-seq
MIRT2473924	hsa-miR-885-5p	CLIP-seq
MIRT2473925	hsa-miR-888	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ING4	Repression	20707719

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001525	Process	Angiogenesis	IBA	21873635
GO:0001701	Process	In utero embryonic development	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	19148554
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	8980223
GO:0002040	Process	Sprouting angiogenesis	IDA	9560344, 10218485
GO:0002092	Process	Positive regulation of receptor internalization	IDA	19424712
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IEA
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	8980223, 10218485
GO:0005886	Component	Plasma membrane	IDA	19424712
GO:0005902	Component	Microvillus	IDA	19424712
GO:0007162	Process	Negative regulation of cell adhesion	IDA	19674970
GO:0007171	Process	Activation of transmembrane receptor protein tyrosine kinase activity	IDA	19424712
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	12958144
GO:0010628	Process	Positive regulation of gene expression	IMP	19148554
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IEA
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IDA	19733541
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030210	Process	Heparin biosynthetic process	IDA	19297368
GO:0030971	Function	Receptor tyrosine kinase binding	IBA	21873635
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	8980223, 19922791
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	19689429
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IEA
GO:0034394	Process	Protein localization to cell surface	IDA	19615361
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10218485, 12958144
GO:0043116	Process	Negative regulation of vascular permeability	IDA	14978158, 19297368
GO:0043122	Process	Regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043393	Process	Regulation of protein binding	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	9660821
GO:0045121	Component	Membrane raft	IDA	19615361
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0048014	Process	Tie signaling pathway	IBA	21873635
GO:0048014	Process	Tie signaling pathway	IDA	19689429, 19922791
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	15851516, 19689429
GO:0050900	Process	Leukocyte migration	TAS
GO:0050918	Process	Positive chemotaxis	IDA	9660821
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	18425120, 19615361
GO:0062023	Component	Collagen-containing extracellular matrix	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18425120, 19615361
GO:0072012	Process	Glomerulus vasculature development	ISS
GO:1905605	Process	Positive regulation of blood-brain barrier permeability	IMP	19148554
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	19674970
GO:2000446	Process	Regulation of macrophage migration inhibitory factor signaling pathway	IEA

Other IDs

• MIM: 601667
• HGNC: 484
• e!Ensembl: ENSG00000154188

Protein

• UniProt ID: Q15389
• Protein name: Angiopoietin-1 (ANG-1)
• Protein function: Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorgan
• PDB: 4EPU, 4JYO, 4K0V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00147	Fibrinogen_C	282 → 496	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Sequence:

  MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
  QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
  QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
  TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
  TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
  TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
  FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
  HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
  GPSYSLRSTTMMIRPLDF

• Sequence length: 498

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Rheumatoid arthritis

Reactome:

Tie2 Signaling
RAF/MAP kinase cascade

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Glaucoma	Glaucoma, Glaucoma, Open-Angle	rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328, rs121909193, rs74315330, rs74315329, rs74315332, rs74315334, rs74315336, rs74315338, rs74315341, rs121909194, rs74315331, rs1558603396, rs387907175, rs587778873, rs587778875, rs104894979, rs137854895, rs766425037, rs72549380, rs148542782, rs541217363, rs753021890, rs771076928, rs56010818, rs777678299, rs1446110883, rs1573274915, rs1587545234, rs751768343, rs944452644	30054594, 29891935
Angioedema	ANGPT1-related hereditary angioedema with normal C1Inh	rs28940870, rs1554996819, rs1554996817, rs112565881, rs2135304804, rs121907951, rs281875174, rs281875178, rs281875168, rs281875170, rs281875171, rs1554995255, rs1554995860, rs886041353, rs978962357, rs1554995774, rs763451792, rs1554995271, rs1554996833, rs1554995260, rs1565169419, rs1565173405, rs1565168898, rs1590822296, rs1565169621, rs1565170287, rs1565170364, rs1565171906, rs1565173309, rs1565174105, rs922149386, rs1590822719, rs1590821401, rs1590822588, rs1590822739, rs1590823884, rs1590826571, rs1590829609, rs1590829616, rs1590829763, rs1590831385, rs1590831432, rs956390201, rs1590831545, rs1590829685, rs778625408, rs1582955358, rs1599142041, rs1945310324, rs1945307391, rs1945416520

Unknown
Disease name	Disease term	dbSNP ID	References
Cirrhosis	Cirrhosis	rs119465999, rs144369314, rs8056684, rs112053857, rs75998507	18626492, 18480750
Septicemia	Septicemia		16005988