SLC25A47 (solute carrier family 25 member 47)

Gene

• Entrez ID: 283600
• Gene name: Solute carrier family 25 member 47
• Gene symbol: SLC25A47
• Synonyms: C14orf68, HDCMP, HDMCP, HMFN1655
• Chromosome: 14
• Chromosome location: 14q32.2
• Summary: This gene encodes a member of a large family of mitochondrial transporters. The nuclear-encoded carrier protein is embedded in the inner mitochondrial membrane. This member of the family is thought to be an uncoupling protein that uncouples mitochondrial

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1357350	hsa-miR-1228	CLIP-seq
MIRT1357351	hsa-miR-329	CLIP-seq
MIRT1357352	hsa-miR-345	CLIP-seq
MIRT1357353	hsa-miR-3622a-3p	CLIP-seq
MIRT1357354	hsa-miR-3622b-3p	CLIP-seq
MIRT1357355	hsa-miR-362-3p	CLIP-seq
MIRT1357356	hsa-miR-4254	CLIP-seq
MIRT1357357	hsa-miR-4292	CLIP-seq
MIRT1357358	hsa-miR-4308	CLIP-seq
MIRT2624377	hsa-miR-138	CLIP-seq
MIRT2624378	hsa-miR-338-3p	CLIP-seq
MIRT2624379	hsa-miR-4456	CLIP-seq
MIRT2624380	hsa-miR-4530	CLIP-seq
MIRT2624381	hsa-miR-541	CLIP-seq
MIRT2624382	hsa-miR-646	CLIP-seq
MIRT2624383	hsa-miR-654-5p	CLIP-seq
MIRT2624384	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006844	Process	Acyl carnitine transport	IBA	21873635
GO:0006865	Process	Amino acid transport	IBA	21873635
GO:0015227	Function	Acyl carnitine transmembrane transporter activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:1902616	Process	Acyl carnitine transmembrane transport	IEA

Other IDs

• MIM: 609911
• HGNC: 20115
• e!Ensembl: ENSG00000140107

Protein

• UniProt ID: Q6Q0C1
• Protein name: Solute carrier family 25 member 47 (Hepatocellular carcinoma down-regulated mitochondrial carrier protein) (Mitochondrial NAD(+) transporter SLC25A47)
• Protein function: Mitochondrial NAD(+) transporter that acts as a 'metabolic gate' in hepatic lipogenesis. Provides NAD(+) substrate to mitochondrial SIRT3 deacetylase and enables its NAD(+)-dependent activities in mitochondrial energy metabolism. This triggers d
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	1 → 83	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	94 → 210	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	214 → 305	Mitochondrial carrier protein	Family

• Sequence:

  MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPV
  CTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAK
  VRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYK
  GSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDV
  IKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVL
  RLARGLLT

• Sequence length: 308

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560