CXCR3 (C-X-C motif chemokine receptor 3)

Gene

• Entrez ID: 2833
• Gene name: C-X-C motif chemokine receptor 3
• Gene symbol: CXCR3
• Synonyms: CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
• Chromosome: X
• Chromosome location: Xq13.1
• Summary: This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant)

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734913	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	33229509
MIRT918206	hsa-miR-15a	CLIP-seq
MIRT918207	hsa-miR-15b	CLIP-seq
MIRT918208	hsa-miR-16	CLIP-seq
MIRT918209	hsa-miR-1910	CLIP-seq
MIRT918210	hsa-miR-195	CLIP-seq
MIRT918211	hsa-miR-3173-3p	CLIP-seq
MIRT918212	hsa-miR-3908	CLIP-seq
MIRT918213	hsa-miR-424	CLIP-seq
MIRT918214	hsa-miR-4428	CLIP-seq
MIRT918215	hsa-miR-4521	CLIP-seq
MIRT918216	hsa-miR-497	CLIP-seq
MIRT918217	hsa-miR-3192	CLIP-seq
MIRT918218	hsa-miR-3689a-3p	CLIP-seq
MIRT918219	hsa-miR-3689c	CLIP-seq
MIRT918220	hsa-miR-4487	CLIP-seq
MIRT918221	hsa-miR-4532	CLIP-seq
MIRT918222	hsa-miR-4728-5p	CLIP-seq
MIRT1972150	hsa-miR-3174	CLIP-seq
MIRT1972151	hsa-miR-3907	CLIP-seq
MIRT1972152	hsa-miR-4271	CLIP-seq
MIRT1972153	hsa-miR-4283	CLIP-seq
MIRT1972154	hsa-miR-4489	CLIP-seq
MIRT1972155	hsa-miR-4725-3p	CLIP-seq
MIRT1972156	hsa-miR-4731-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TBX21	Activation	14500650;21540308

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002685	Process	Regulation of leukocyte migration	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	9064356
GO:0005515	Function	Protein binding	IPI	23170857, 32296183
GO:0005737	Component	Cytoplasm	TAS	10903743
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9064356
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	TAS	10903763
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA	21873635
GO:0007155	Process	Cell adhesion	TAS	10942362
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	11554781
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0010818	Process	T cell chemotaxis	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA	21873635
GO:0016494	Function	C-X-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA	21873635
GO:0019956	Function	Chemokine binding	IPI	11554781
GO:0019957	Function	C-C chemokine binding	IBA	21873635
GO:0030155	Process	Regulation of cell adhesion	IDA	19703720
GO:0042802	Function	Identical protein binding	IPI	23121557, 23170857
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

Other IDs

• MIM: 300574
• HGNC: 4540
• e!Ensembl: ENSG00000186810

Protein

• UniProt ID: P49682
• Protein name: C-X-C chemokine receptor type 3 (CXC-R3) (CXCR-3) (CKR-L2) (G protein-coupled receptor 9) (Interferon-inducible protein 10 receptor) (IP-10 receptor) (CD antigen CD183)
• Protein function: [Isoform 1]: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway (PubMed:12782716). Binds
• PDB: 8HNK, 8HNL, 8HNM, 8HNN, 8K2W, 8K2X, 8XXY, 8XXZ, 8XYI, 8XYK, 8Y0H, 8Y0N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	70 → 318	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
  SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
  SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
  LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
  VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
  SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
  SEASYSGL

• Sequence length: 368

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autoimmune diseases	Autoimmune Diseases	rs41285370, rs869025224	12517959
Dermatitis	Dermatitis, Atopic, Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	18249437, 25724174
Glomerulonephritis	Glomerulonephritis	rs778043831	12517959

Unknown
Disease name	Disease term	dbSNP ID	References
Alopecia areata	Alopecia Areata		22358057
Bright disease	Bright Disease		12517959
Eczema	Eczema, Infantile		18249437
Pleural diseases	Pleural Diseases		21357438
Stroke	Cerebrovascular accident, Acute Cerebrovascular Accidents		12374626