Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
283237 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Tetratricopeptide repeat domain 9C |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
TTC9C |
SynonymsGene synonyms aliases
|
- |
ChromosomeChromosome number
|
11 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
11q12.3 |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8N5M4 |
Protein name |
Tetratricopeptide repeat protein 9C (TPR repeat protein 9C) |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF07719 |
TPR_2 |
108 → 141 |
Tetratricopeptide repeat |
Repeat |
|
Sequence |
MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALT PEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFH LQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG
|
|
Sequence length |
171 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Prostate cancer |
Malignant neoplasm of prostate |
rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 |
17013881 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Prostatic neoplasms |
Prostatic Neoplasms |
|
17013881 |
|