GNGT2 (G protein subunit gamma transducin 2)

Gene

• Entrez ID: 2793
• Gene name: G protein subunit gamma transducin 2
• Gene symbol: GNGT2
• Synonyms: G-GAMMA-8, G-GAMMA-C, GNG9, GNGT8, HG3I
• Chromosome: 17
• Chromosome location: 17q21.32
• Summary: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. S

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018854	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IDA	10570481
GO:0003924	Function	GTPase activity	NAS	9286705
GO:0005834	Component	Heterotrimeric G-protein complex	IBA	21873635
GO:0005834	Component	Heterotrimeric G-protein complex	IDA	10570481
GO:0005834	Component	Heterotrimeric G-protein complex	NAS	9286705
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	9286705
GO:0007602	Process	Phototransduction	NAS	9286705
GO:0031680	Component	G-protein beta/gamma-subunit complex	IBA	21873635
GO:0031681	Function	G-protein beta-subunit binding	IBA	21873635

Other IDs

• MIM: 139391
• HGNC: 4412
• e!Ensembl: ENSG00000167083

Protein

• UniProt ID: O14610
• Protein name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 (G gamma-C) (G-gamma-8) (G-gamma-9) (Guanine nucleotide binding protein gamma transducing activity polypeptide 2)
• Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00631	G-gamma	5 → 69	GGL domain	Domain

• Sequence:

  MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
  KEKGGCLIS

• Sequence length: 69

Pathways

KEGG:

Ras signaling pathway
Chemokine signaling pathway
Hormone signaling
PI3K-Akt signaling pathway
Apelin signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Relaxin signaling pathway
Morphine addiction
Alcoholism
Human cytomegalovirus infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer

Reactome:

Activation of G protein gated Potassium channels
G-protein activation
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
ADP signalling through P2Y purinoceptor 12
G beta:gamma signalling through PI3Kgamma
Prostacyclin signalling through prostacyclin receptor
Adrenaline,noradrenaline inhibits insulin secretion
Ca2+ pathway
G alpha (q) signalling events
G alpha (12/13) signalling events
G beta:gamma signalling through PLC beta
G alpha (s) signalling events
ADP signalling through P2Y purinoceptor 1
G alpha (i) signalling events
G alpha (z) signalling events
Glucagon-type ligand receptors
Thromboxane signalling through TP receptor
Vasopressin regulates renal water homeostasis via Aquaporins
Thrombin signalling through proteinase activated receptors (PARs)
Presynaptic function of Kainate receptors
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
G beta:gamma signalling through BTK
G beta:gamma signalling through CDC42
Extra-nuclear estrogen signaling
ADORA2B mediated anti-inflammatory cytokines production
Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Cholangitis	Cholangitis, Sclerosing		27992413