MCAT (malonyl-CoA-acyl carrier protein transacylase)

Gene

• Entrez ID: 27349
• Gene name: Malonyl-CoA-acyl carrier protein transacylase
• Gene symbol: MCAT
• Synonyms: FASN2C, MCT, MCT1, MT, NET62, OPA15, fabD
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex tha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027789	hsa-miR-98-5p	Microarray	19088304
MIRT032453	hsa-let-7b-5p	Proteomics	18668040
MIRT1136441	hsa-miR-3664-3p	CLIP-seq
MIRT1136442	hsa-miR-4279	CLIP-seq
MIRT1136443	hsa-miR-4433	CLIP-seq
MIRT1136444	hsa-miR-4459	CLIP-seq
MIRT1136445	hsa-miR-4768-3p	CLIP-seq
MIRT2268819	hsa-miR-103a	CLIP-seq
MIRT2268820	hsa-miR-107	CLIP-seq
MIRT2268821	hsa-miR-1184	CLIP-seq
MIRT2268822	hsa-miR-1286	CLIP-seq
MIRT2268823	hsa-miR-2278	CLIP-seq
MIRT2268824	hsa-miR-4436a	CLIP-seq
MIRT2268825	hsa-miR-4438	CLIP-seq
MIRT2268826	hsa-miR-4676-5p	CLIP-seq
MIRT2268827	hsa-miR-575	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MTF1	Activation	15378601

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004312	Function	Fatty acid synthase activity	IDA	12882974
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IBA	21873635
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IDA	12882974
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	TAS
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA	12882974
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006633	Process	Fatty acid biosynthetic process	IBA	21873635
GO:0006633	Process	Fatty acid biosynthetic process	IDA	12882974
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	TAS

Other IDs

• MIM: 614479
• HGNC: 29622
• e!Ensembl: ENSG00000100294

Protein

• UniProt ID: Q8IVS2
• Protein name: Malonyl-CoA-acyl carrier protein transacylase, mitochondrial (MCT) (EC 2.3.1.39) (Mitochondrial malonyl CoA:ACP acyltransferase) (Mitochondrial malonyltransferase) ([Acyl-carrier-protein] malonyltransferase)
• Protein function: Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1) (PubMed:12882974, PubMed:19549604). This suggests the existence of the biosynthesis of f
• PDB: 2C2N, 8CSP, 8CSQ, 8CSR, 8CSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00698	Acyl_transf_1	64 → 346	Acyl transferase domain	Domain

• Sequence:

  MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPG
  QCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC
  QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE
  AMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISG
  HQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSN
  VHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKS
  CNMQAWKSYSAVDVLQTLEHVDLDPQEPPR

• Sequence length: 390

Pathways

KEGG:

Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism

Reactome:

Mitochondrial Fatty Acid Beta-Oxidation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Optic atrophy	Autosomal recessive isolated optic atrophy	rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299, rs61750185, rs672601379, rs727504060, rs786204830, rs794727804, rs199946797, rs863224127, rs863224131, rs863224134, rs863224906, rs372054380, rs886037828, rs764791523, rs145639028, rs1057519312, rs1064794257, rs1064794656, rs1064797303, rs774265764, rs760337383, rs1553784985, rs72653786, rs1555229948, rs1555119216, rs761743852, rs1553785338, rs1020764190, rs782581701, rs1560408865, rs761460379, rs773022324, rs782740998, rs1560327427, rs80356528, rs1734162973, rs1716524583, rs1057368575
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	14623372