STK39 (serine/threonine kinase 39)

Gene

• Entrez ID: 27347
• Gene name: Serine/threonine kinase 39
• Gene symbol: STK39
• Synonyms: DCHT, PASK, SPAK
• Chromosome: 2
• Chromosome location: 2q24.3
• Summary: This gene encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The cat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1398222	hsa-miR-1179	CLIP-seq
MIRT1398223	hsa-miR-1245b-3p	CLIP-seq
MIRT1398224	hsa-miR-1321	CLIP-seq
MIRT1398225	hsa-miR-1827	CLIP-seq
MIRT1398226	hsa-miR-2276	CLIP-seq
MIRT1398227	hsa-miR-2467-3p	CLIP-seq
MIRT1398228	hsa-miR-25	CLIP-seq
MIRT1398229	hsa-miR-2682	CLIP-seq
MIRT1398230	hsa-miR-296-3p	CLIP-seq
MIRT1398231	hsa-miR-3184	CLIP-seq
MIRT1398232	hsa-miR-32	CLIP-seq
MIRT1398233	hsa-miR-363	CLIP-seq
MIRT1398234	hsa-miR-367	CLIP-seq
MIRT1398235	hsa-miR-3689a-3p	CLIP-seq
MIRT1398236	hsa-miR-3689c	CLIP-seq
MIRT1398237	hsa-miR-376c	CLIP-seq
MIRT1398238	hsa-miR-3923	CLIP-seq
MIRT1398239	hsa-miR-3940-5p	CLIP-seq
MIRT1398240	hsa-miR-423-5p	CLIP-seq
MIRT1398241	hsa-miR-4263	CLIP-seq
MIRT1398242	hsa-miR-4317	CLIP-seq
MIRT1398243	hsa-miR-4419a	CLIP-seq
MIRT1398244	hsa-miR-449c	CLIP-seq
MIRT1398245	hsa-miR-4507	CLIP-seq
MIRT1398246	hsa-miR-4510	CLIP-seq
MIRT1398247	hsa-miR-4635	CLIP-seq
MIRT1398248	hsa-miR-4651	CLIP-seq
MIRT1398249	hsa-miR-4696	CLIP-seq
MIRT1398250	hsa-miR-4721	CLIP-seq
MIRT1398251	hsa-miR-4724-3p	CLIP-seq
MIRT1398252	hsa-miR-4728-5p	CLIP-seq
MIRT1398253	hsa-miR-4739	CLIP-seq
MIRT1398254	hsa-miR-4756-5p	CLIP-seq
MIRT1398255	hsa-miR-4775	CLIP-seq
MIRT1398256	hsa-miR-4799-5p	CLIP-seq
MIRT1398257	hsa-miR-4803	CLIP-seq
MIRT1398258	hsa-miR-488	CLIP-seq
MIRT1398259	hsa-miR-5096	CLIP-seq
MIRT1398260	hsa-miR-526b	CLIP-seq
MIRT1398261	hsa-miR-548a-5p	CLIP-seq
MIRT1398262	hsa-miR-548ab	CLIP-seq
MIRT1398263	hsa-miR-548ak	CLIP-seq
MIRT1398264	hsa-miR-548b-5p	CLIP-seq
MIRT1398265	hsa-miR-548c-5p	CLIP-seq
MIRT1398266	hsa-miR-548d-5p	CLIP-seq
MIRT1398267	hsa-miR-548h	CLIP-seq
MIRT1398268	hsa-miR-548i	CLIP-seq
MIRT1398269	hsa-miR-548j	CLIP-seq
MIRT1398270	hsa-miR-548k	CLIP-seq
MIRT1398271	hsa-miR-548l	CLIP-seq
MIRT1398272	hsa-miR-548w	CLIP-seq
MIRT1398273	hsa-miR-548y	CLIP-seq
MIRT1398274	hsa-miR-559	CLIP-seq
MIRT1398275	hsa-miR-576-5p	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT1398277	hsa-miR-587	CLIP-seq
MIRT1398278	hsa-miR-608	CLIP-seq
MIRT1398279	hsa-miR-616	CLIP-seq
MIRT1398280	hsa-miR-890	CLIP-seq
MIRT1398281	hsa-miR-92a	CLIP-seq
MIRT1398282	hsa-miR-92b	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT1398226	hsa-miR-2276	CLIP-seq
MIRT1398223	hsa-miR-1245b-3p	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT2119358	hsa-miR-1297	CLIP-seq
MIRT1398224	hsa-miR-1321	CLIP-seq
MIRT2119359	hsa-miR-26a	CLIP-seq
MIRT2119360	hsa-miR-26b	CLIP-seq
MIRT1398230	hsa-miR-296-3p	CLIP-seq
MIRT1398243	hsa-miR-4419a	CLIP-seq
MIRT2119361	hsa-miR-4428	CLIP-seq
MIRT2119362	hsa-miR-4465	CLIP-seq
MIRT1398246	hsa-miR-4510	CLIP-seq
MIRT1398251	hsa-miR-4724-3p	CLIP-seq
MIRT1398252	hsa-miR-4728-5p	CLIP-seq
MIRT1398253	hsa-miR-4739	CLIP-seq
MIRT1398254	hsa-miR-4756-5p	CLIP-seq
MIRT1398258	hsa-miR-488	CLIP-seq
MIRT1398261	hsa-miR-548a-5p	CLIP-seq
MIRT1398262	hsa-miR-548ab	CLIP-seq
MIRT1398263	hsa-miR-548ak	CLIP-seq
MIRT1398264	hsa-miR-548b-5p	CLIP-seq
MIRT1398265	hsa-miR-548c-5p	CLIP-seq
MIRT1398266	hsa-miR-548d-5p	CLIP-seq
MIRT1398267	hsa-miR-548h	CLIP-seq
MIRT1398268	hsa-miR-548i	CLIP-seq
MIRT1398269	hsa-miR-548j	CLIP-seq
MIRT1398270	hsa-miR-548k	CLIP-seq
MIRT1398271	hsa-miR-548l	CLIP-seq
MIRT1398272	hsa-miR-548w	CLIP-seq
MIRT1398273	hsa-miR-548y	CLIP-seq
MIRT1398274	hsa-miR-559	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT2119363	hsa-miR-590-3p	CLIP-seq
MIRT1398227	hsa-miR-2467-3p	CLIP-seq
MIRT1398239	hsa-miR-3940-5p	CLIP-seq
MIRT1398245	hsa-miR-4507	CLIP-seq
MIRT1398250	hsa-miR-4721	CLIP-seq
MIRT1398255	hsa-miR-4775	CLIP-seq
MIRT1398258	hsa-miR-488	CLIP-seq
MIRT2341558	hsa-miR-513b	CLIP-seq
MIRT1398271	hsa-miR-548l	CLIP-seq
MIRT1398280	hsa-miR-890	CLIP-seq
MIRT2433645	hsa-miR-340	CLIP-seq
MIRT2460694	hsa-miR-3140-3p	CLIP-seq
MIRT2460695	hsa-miR-323-3p	CLIP-seq
MIRT2460696	hsa-miR-3616-5p	CLIP-seq
MIRT2460697	hsa-miR-3647-5p	CLIP-seq
MIRT2460698	hsa-miR-573	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT2635458	hsa-miR-22	CLIP-seq
MIRT1398226	hsa-miR-2276	CLIP-seq
MIRT2635459	hsa-miR-3123	CLIP-seq
MIRT2460694	hsa-miR-3140-3p	CLIP-seq
MIRT2460695	hsa-miR-323-3p	CLIP-seq
MIRT2433645	hsa-miR-340	CLIP-seq
MIRT2460696	hsa-miR-3616-5p	CLIP-seq
MIRT2460697	hsa-miR-3647-5p	CLIP-seq
MIRT2635460	hsa-miR-3691-5p	CLIP-seq
MIRT2635461	hsa-miR-3925-5p	CLIP-seq
MIRT2635462	hsa-miR-4311	CLIP-seq
MIRT2635463	hsa-miR-4318	CLIP-seq
MIRT2635464	hsa-miR-4422	CLIP-seq
MIRT2635465	hsa-miR-4693-5p	CLIP-seq
MIRT2635466	hsa-miR-4752	CLIP-seq
MIRT2635467	hsa-miR-4769-3p	CLIP-seq
MIRT2635468	hsa-miR-4772-3p	CLIP-seq
MIRT2635469	hsa-miR-4778-5p	CLIP-seq
MIRT2635470	hsa-miR-483-3p	CLIP-seq
MIRT2635471	hsa-miR-544	CLIP-seq
MIRT2635472	hsa-miR-558	CLIP-seq
MIRT2460698	hsa-miR-573	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT2635473	hsa-miR-630	CLIP-seq
MIRT2635474	hsa-miR-892a	CLIP-seq
MIRT2635475	hsa-miR-944	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT2635458	hsa-miR-22	CLIP-seq
MIRT2635459	hsa-miR-3123	CLIP-seq
MIRT2460694	hsa-miR-3140-3p	CLIP-seq
MIRT2460695	hsa-miR-323-3p	CLIP-seq
MIRT2460696	hsa-miR-3616-5p	CLIP-seq
MIRT2460697	hsa-miR-3647-5p	CLIP-seq
MIRT2635460	hsa-miR-3691-5p	CLIP-seq
MIRT2635461	hsa-miR-3925-5p	CLIP-seq
MIRT2635462	hsa-miR-4311	CLIP-seq
MIRT2635463	hsa-miR-4318	CLIP-seq
MIRT2635464	hsa-miR-4422	CLIP-seq
MIRT2635465	hsa-miR-4693-5p	CLIP-seq
MIRT2635466	hsa-miR-4752	CLIP-seq
MIRT2635467	hsa-miR-4769-3p	CLIP-seq
MIRT2635472	hsa-miR-558	CLIP-seq
MIRT2460698	hsa-miR-573	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT2635474	hsa-miR-892a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	18787102
RELA	Activation	18787102

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	IMP	10980603
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	24393035
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	10980603, 16669787
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	16669787, 21423148, 24393035
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IMP	10980603
GO:0005829	Component	Cytosol	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007165	Process	Signal transduction	IDA	24393035
GO:0007165	Process	Signal transduction	IMP	16669787
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	27400149
GO:0016301	Function	Kinase activity	ISS
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	24393035
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	10980603
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	24393035
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	10980603, 16669787
GO:0018107	Process	Peptidyl-threonine phosphorylation	ISS
GO:0019898	Component	Extrinsic component of membrane	ISS
GO:0019901	Function	Protein kinase binding	IEA
GO:0032414	Process	Positive regulation of ion transmembrane transporter activity	ISS
GO:0035556	Process	Intracellular signal transduction	IDA	24393035
GO:0036438	Process	Maintenance of lens transparency	ISS
GO:0038146	Process	Chemokine (C-X-C motif) ligand 12 signaling pathway	IMP	27400149
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043268	Process	Positive regulation of potassium ion transport	IEA
GO:0046777	Process	Protein autophosphorylation	IMP	10980603
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050801	Process	Ion homeostasis	IEA
GO:0071476	Process	Cellular hypotonic response	IC	24393035
GO:0090188	Process	Negative regulation of pancreatic juice secretion	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1901017	Process	Negative regulation of potassium ion transmembrane transporter activity	IDA	24393035
GO:1901380	Process	Negative regulation of potassium ion transmembrane transport	IDA	24393035
GO:1905408	Process	Negative regulation of creatine transmembrane transporter activity	IDA	25531585
GO:1990869	Process	Cellular response to chemokine	IMP	27400149
GO:2000650	Process	Negative regulation of sodium ion transmembrane transporter activity	IDA	25531585

Other IDs

• MIM: 607648
• HGNC: 17717
• e!Ensembl: ENSG00000198648

Protein

• UniProt ID: Q9UEW8
• Protein name: STE20/SPS1-related proline-alanine-rich protein kinase (Ste-20-related kinase) (EC 2.7.11.1) (DCHT) (Serine/threonine-protein kinase 39)
• Protein function: Effector serine/threonine-protein kinase component of the WNK-SPAK/OSR1 kinase cascade, which is involved in various processes, such as ion transport, response to hypertonic stress and blood pressure (PubMed:16669787, PubMed:18270262, PubMed:213
• PDB: 7O86
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	63 → 337	Protein kinase domain	Domain
  PF12202	OSR1_C	452 → 509	Oxidative-stress-responsive kinase 1 C-terminal domain	Domain

• Sequence:

  MAEPSGSPVHVQLPQQAAPVTAAAAAAPAAATAAPAPAAPAAPAPAPAPAAQAVGWPICR
  DAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPN
  VVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGL
  DYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMA
  PEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDK
  EMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQR
  AKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSAS
  TIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTAD
  GVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFA
  QLSVS

• Sequence length: 545

Pathways

KEGG:

Parathyroid hormone synthesis, secretion and action

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	18348195
Hypertension	Hypertensive disease	rs13306026, rs13333226	22949526
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382	27602772
Parkinson disease	Parkinson Disease	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	22438815