HPGDS (hematopoietic prostaglandin D synthase)

Gene

• Entrez ID: 27306
• Gene name: Hematopoietic prostaglandin D synthase
• Gene symbol: HPGDS
• Synonyms: GSTS, GSTS1, GSTS1-1, PGD2, PGDS
• Chromosome: 4
• Chromosome location: 4q22.3
• Summary: Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1054141	hsa-miR-3128	CLIP-seq
MIRT1054142	hsa-miR-3150a-3p	CLIP-seq
MIRT1054143	hsa-miR-3175	CLIP-seq
MIRT1054144	hsa-miR-34a	CLIP-seq
MIRT1054145	hsa-miR-34c-5p	CLIP-seq
MIRT1054146	hsa-miR-3681	CLIP-seq
MIRT1054147	hsa-miR-4419a	CLIP-seq
MIRT1054148	hsa-miR-4460	CLIP-seq
MIRT1054149	hsa-miR-4487	CLIP-seq
MIRT1054150	hsa-miR-449a	CLIP-seq
MIRT1054151	hsa-miR-449b	CLIP-seq
MIRT1054152	hsa-miR-4510	CLIP-seq
MIRT1054153	hsa-miR-4633-3p	CLIP-seq
MIRT1054154	hsa-miR-4667-5p	CLIP-seq
MIRT1054155	hsa-miR-4700-5p	CLIP-seq
MIRT1054156	hsa-miR-4720-5p	CLIP-seq
MIRT1054157	hsa-miR-4727-3p	CLIP-seq
MIRT1054158	hsa-miR-4728-5p	CLIP-seq
MIRT1054159	hsa-miR-4731-5p	CLIP-seq
MIRT1054160	hsa-miR-4799-3p	CLIP-seq
MIRT1054161	hsa-miR-939	CLIP-seq
MIRT2012279	hsa-miR-548c-3p	CLIP-seq
MIRT2429706	hsa-miR-3185	CLIP-seq
MIRT2012279	hsa-miR-548c-3p	CLIP-seq
MIRT2012279	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
POU2F1	Unknown	10998423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IDA	12627223
GO:0004364	Function	Glutathione transferase activity	IBA	21873635
GO:0004667	Function	Prostaglandin-D synthase activity	IDA	12627223
GO:0005509	Function	Calcium ion binding	IDA	12627223
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	TAS	9353279
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006693	Process	Prostaglandin metabolic process	IDA	12627223
GO:0006749	Process	Glutathione metabolic process	IBA	21873635
GO:0007165	Process	Signal transduction	NAS	9353279
GO:0007626	Process	Locomotory behavior	TAS	10781097
GO:0019371	Process	Cyclooxygenase pathway	TAS
GO:0042803	Function	Protein homodimerization activity	IPI	12627223
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS

Other IDs

• MIM: 602598
• HGNC: 17890
• e!Ensembl: ENSG00000163106

Protein

• UniProt ID: O60760
• Protein name: Hematopoietic prostaglandin D synthase (H-PGDS) (EC 5.3.99.2) (GST class-sigma) (Glutathione S-transferase) (EC 2.5.1.18) (Glutathione-dependent PGD synthase) (Glutathione-requiring prostaglandin D synthase) (Prostaglandin-H2 D-isomerase)
• Protein function: Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of ary
• PDB: 1IYH, 1IYI, 1V40, 2CVD, 2VCQ, 2VCW, 2VCX, 2VCZ, 2VD0, 2VD1, 3EE2, 3KXO, 3VI5, 3VI7, 4EC0, 4EDY, 4EDZ, 4EE0, 5AIS, 5AIV, 5AIX, 5YWE, 5YWX, 5YX1, 6N4E, 6W58, 6W8H, 6ZTC, 7JR6, 7JR8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	4 → 73	Glutathione S-transferase, N-terminal domain	Domain
  PF14497	GST_C_3	92 → 194	Glutathione S-transferase, C-terminal domain	Domain

• Sequence:

  MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
  LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
  TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
  VQAIPAVANWIKRRPQTKL

• Sequence length: 199

Pathways

KEGG:

Glutathione metabolism
Arachidonic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis - DNA adducts

Reactome:

Glutathione conjugation
Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	25358668, 22874804, 22959778, 19528963

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		22374552
Kidney neoplasm	Kidney Neoplasm		28321044
Kidney cancer	Malignant neoplasm of kidney		28321044
Mood disorder	Mood Disorders		25445355
Psychosis	Psychotic Disorders		22959778
Testicular neoplasms	Testicular Neoplasms		23666239
Testicular germ cell tumor	Testicular Germ Cell Tumor		28604732, 28604728, 23666239