STK36 (serine/threonine kinase 36)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
27148 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Serine/threonine kinase 36 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
STK36 |
SynonymsGene synonyms aliases
|
CILD46, FU |
ChromosomeChromosome number
|
2 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
2q35 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a member of the serine/threonine kinase family of enzymes. This family member is similar to a Drosophila protein that plays a key role in the Hedgehog signaling pathway. This human protein is a positive regulator of the GLI zinc-finger t |
miRNAmiRNA information provided by mirtarbase database.
|
miRTarBase ID |
miRNA |
Experiments |
Reference |
MIRT022162 |
hsa-miR-124-3p |
Microarray |
18668037 |
MIRT614439 |
hsa-miR-8485 |
HITS-CLIP |
23824327 |
MIRT614438 |
hsa-miR-329-3p |
HITS-CLIP |
23824327 |
MIRT614437 |
hsa-miR-362-3p |
HITS-CLIP |
23824327 |
MIRT629817 |
hsa-miR-603 |
HITS-CLIP |
23824327 |
MIRT614436 |
hsa-miR-4789-3p |
HITS-CLIP |
23824327 |
MIRT614435 |
hsa-miR-3941 |
HITS-CLIP |
23824327 |
MIRT614434 |
hsa-miR-4789-5p |
HITS-CLIP |
23824327 |
MIRT614439 |
hsa-miR-8485 |
HITS-CLIP |
23824327 |
MIRT614438 |
hsa-miR-329-3p |
HITS-CLIP |
23824327 |
MIRT614437 |
hsa-miR-362-3p |
HITS-CLIP |
23824327 |
MIRT614436 |
hsa-miR-4789-3p |
HITS-CLIP |
23824327 |
MIRT614435 |
hsa-miR-3941 |
HITS-CLIP |
23824327 |
MIRT614434 |
hsa-miR-4789-5p |
HITS-CLIP |
23824327 |
MIRT734321 |
hsa-miR-21-5p |
Immunofluorescence, qRT-PCR, RNA-seq, Western blotting |
31735554 |
MIRT734322 |
hsa-miR-146b-3p |
Immunofluorescence, qRT-PCR, RNA-seq, Western blotting |
31735554 |
MIRT734323 |
hsa-miR-5571-3p |
Immunofluorescence, qRT-PCR, RNA-seq, Western blotting |
31735554 |
MIRT734324 |
hsa-miR-6503-3p |
Immunofluorescence, qRT-PCR, RNA-seq, Western blotting |
31735554 |
MIRT614439 |
hsa-miR-8485 |
HITS-CLIP |
23824327 |
MIRT614438 |
hsa-miR-329-3p |
HITS-CLIP |
23824327 |
MIRT614437 |
hsa-miR-362-3p |
HITS-CLIP |
23824327 |
MIRT629817 |
hsa-miR-603 |
HITS-CLIP |
23824327 |
MIRT614436 |
hsa-miR-4789-3p |
HITS-CLIP |
23824327 |
MIRT614435 |
hsa-miR-3941 |
HITS-CLIP |
23824327 |
MIRT614434 |
hsa-miR-4789-5p |
HITS-CLIP |
23824327 |
MIRT614439 |
hsa-miR-8485 |
HITS-CLIP |
23824327 |
MIRT614438 |
hsa-miR-329-3p |
HITS-CLIP |
23824327 |
MIRT614437 |
hsa-miR-362-3p |
HITS-CLIP |
23824327 |
MIRT614436 |
hsa-miR-4789-3p |
HITS-CLIP |
23824327 |
MIRT614435 |
hsa-miR-3941 |
HITS-CLIP |
23824327 |
MIRT614434 |
hsa-miR-4789-5p |
HITS-CLIP |
23824327 |
MIRT1397927 |
hsa-miR-124 |
CLIP-seq |
|
MIRT1397928 |
hsa-miR-1343 |
CLIP-seq |
|
MIRT1397929 |
hsa-miR-329 |
CLIP-seq |
|
MIRT1397930 |
hsa-miR-3714 |
CLIP-seq |
|
MIRT1397931 |
hsa-miR-3910 |
CLIP-seq |
|
MIRT1397932 |
hsa-miR-4521 |
CLIP-seq |
|
MIRT1397933 |
hsa-miR-4640-5p |
CLIP-seq |
|
MIRT1397934 |
hsa-miR-4726-5p |
CLIP-seq |
|
MIRT1397935 |
hsa-miR-506 |
CLIP-seq |
|
MIRT2119282 |
hsa-miR-2117 |
CLIP-seq |
|
MIRT2119283 |
hsa-miR-3163 |
CLIP-seq |
|
MIRT2119284 |
hsa-miR-4264 |
CLIP-seq |
|
MIRT2119285 |
hsa-miR-4273 |
CLIP-seq |
|
MIRT2119286 |
hsa-miR-4677-5p |
CLIP-seq |
|
MIRT2119287 |
hsa-miR-4797-3p |
CLIP-seq |
|
MIRT2119288 |
hsa-miR-578 |
CLIP-seq |
|
MIRT1397927 |
hsa-miR-124 |
CLIP-seq |
|
MIRT2341457 |
hsa-miR-1297 |
CLIP-seq |
|
MIRT1397928 |
hsa-miR-1343 |
CLIP-seq |
|
MIRT2341458 |
hsa-miR-2355-3p |
CLIP-seq |
|
MIRT2341459 |
hsa-miR-26a |
CLIP-seq |
|
MIRT2341460 |
hsa-miR-26b |
CLIP-seq |
|
MIRT2341461 |
hsa-miR-3192 |
CLIP-seq |
|
MIRT2341462 |
hsa-miR-4300 |
CLIP-seq |
|
MIRT2341463 |
hsa-miR-4465 |
CLIP-seq |
|
MIRT2341464 |
hsa-miR-4484 |
CLIP-seq |
|
MIRT1397935 |
hsa-miR-506 |
CLIP-seq |
|
MIRT2341465 |
hsa-miR-520d-5p |
CLIP-seq |
|
MIRT2341466 |
hsa-miR-524-5p |
CLIP-seq |
|
MIRT2341467 |
hsa-miR-548an |
CLIP-seq |
|
MIRT2341468 |
hsa-miR-676 |
CLIP-seq |
|
MIRT2341469 |
hsa-miR-920 |
CLIP-seq |
|
MIRT2395353 |
hsa-miR-581 |
CLIP-seq |
|
MIRT2635416 |
hsa-miR-1208 |
CLIP-seq |
|
MIRT1397927 |
hsa-miR-124 |
CLIP-seq |
|
MIRT1397928 |
hsa-miR-1343 |
CLIP-seq |
|
MIRT2635417 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT2635418 |
hsa-miR-3120-5p |
CLIP-seq |
|
MIRT2635419 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT2635420 |
hsa-miR-3155 |
CLIP-seq |
|
MIRT2635421 |
hsa-miR-3155b |
CLIP-seq |
|
MIRT2635422 |
hsa-miR-370 |
CLIP-seq |
|
MIRT1397930 |
hsa-miR-3714 |
CLIP-seq |
|
MIRT1397931 |
hsa-miR-3910 |
CLIP-seq |
|
MIRT2635423 |
hsa-miR-4438 |
CLIP-seq |
|
MIRT1397932 |
hsa-miR-4521 |
CLIP-seq |
|
MIRT1397933 |
hsa-miR-4640-5p |
CLIP-seq |
|
MIRT2635424 |
hsa-miR-4646-5p |
CLIP-seq |
|
MIRT2635425 |
hsa-miR-4699-5p |
CLIP-seq |
|
MIRT1397934 |
hsa-miR-4726-5p |
CLIP-seq |
|
MIRT2635426 |
hsa-miR-4731-5p |
CLIP-seq |
|
MIRT2635427 |
hsa-miR-4747-5p |
CLIP-seq |
|
MIRT2635428 |
hsa-miR-484 |
CLIP-seq |
|
MIRT1397935 |
hsa-miR-506 |
CLIP-seq |
|
MIRT2635429 |
hsa-miR-548ac |
CLIP-seq |
|
MIRT2635430 |
hsa-miR-548d-3p |
CLIP-seq |
|
MIRT2635431 |
hsa-miR-548z |
CLIP-seq |
|
MIRT2635432 |
hsa-miR-708 |
CLIP-seq |
|
MIRT2635433 |
hsa-miR-760 |
CLIP-seq |
|
MIRT2635416 |
hsa-miR-1208 |
CLIP-seq |
|
MIRT1397927 |
hsa-miR-124 |
CLIP-seq |
|
MIRT2692258 |
hsa-miR-1252 |
CLIP-seq |
|
MIRT1397928 |
hsa-miR-1343 |
CLIP-seq |
|
MIRT2635417 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT2692259 |
hsa-miR-3120-3p |
CLIP-seq |
|
MIRT2635418 |
hsa-miR-3120-5p |
CLIP-seq |
|
MIRT2635419 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT2635420 |
hsa-miR-3155 |
CLIP-seq |
|
MIRT2635421 |
hsa-miR-3155b |
CLIP-seq |
|
MIRT2119283 |
hsa-miR-3163 |
CLIP-seq |
|
MIRT2341461 |
hsa-miR-3192 |
CLIP-seq |
|
MIRT2635422 |
hsa-miR-370 |
CLIP-seq |
|
MIRT1397930 |
hsa-miR-3714 |
CLIP-seq |
|
MIRT1397931 |
hsa-miR-3910 |
CLIP-seq |
|
MIRT2692260 |
hsa-miR-3942-5p |
CLIP-seq |
|
MIRT2692261 |
hsa-miR-4282 |
CLIP-seq |
|
MIRT2692262 |
hsa-miR-4314 |
CLIP-seq |
|
MIRT2692263 |
hsa-miR-4434 |
CLIP-seq |
|
MIRT2635423 |
hsa-miR-4438 |
CLIP-seq |
|
MIRT2692264 |
hsa-miR-4516 |
CLIP-seq |
|
MIRT1397932 |
hsa-miR-4521 |
CLIP-seq |
|
MIRT1397933 |
hsa-miR-4640-5p |
CLIP-seq |
|
MIRT2635424 |
hsa-miR-4646-5p |
CLIP-seq |
|
MIRT2692265 |
hsa-miR-4699-3p |
CLIP-seq |
|
MIRT2635425 |
hsa-miR-4699-5p |
CLIP-seq |
|
MIRT2692266 |
hsa-miR-4703-5p |
CLIP-seq |
|
MIRT1397934 |
hsa-miR-4726-5p |
CLIP-seq |
|
MIRT2635426 |
hsa-miR-4731-5p |
CLIP-seq |
|
MIRT2635427 |
hsa-miR-4747-5p |
CLIP-seq |
|
MIRT2692267 |
hsa-miR-4793-5p |
CLIP-seq |
|
MIRT2635428 |
hsa-miR-484 |
CLIP-seq |
|
MIRT1397935 |
hsa-miR-506 |
CLIP-seq |
|
MIRT2635429 |
hsa-miR-548ac |
CLIP-seq |
|
MIRT2635430 |
hsa-miR-548d-3p |
CLIP-seq |
|
MIRT2635431 |
hsa-miR-548z |
CLIP-seq |
|
MIRT2692268 |
hsa-miR-563 |
CLIP-seq |
|
MIRT2692269 |
hsa-miR-570 |
CLIP-seq |
|
MIRT2635432 |
hsa-miR-708 |
CLIP-seq |
|
MIRT2635433 |
hsa-miR-760 |
CLIP-seq |
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q9NRP7 |
Protein name |
Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused homolog) |
Protein function |
Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors (PubMed:10806483). Controls the activity of the transcriptional regulators GLI1, GLI2 and G |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF00069 |
Pkinase |
4 → 254 |
Protein kinase domain |
Domain |
|
Sequence |
MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRH PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT ADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKNFLQGLLTKDPR QRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR ILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILAS ELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEW QHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLS SLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFA CTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGN SRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISS ALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYS CCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLVFRLQNLPCGM EKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRL TPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEG ELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLC PSFLNQLRQAPHGSEFLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQV CCYHLPLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQPLLTSD LLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSVRAHTYRLLGHLLQHS MALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQL LGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSL QQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM
|
|
Sequence length |
1315 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Amyotrophic lateral sclerosis |
Amyotrophic Lateral Sclerosis |
rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733, rs80356731, rs80356726, rs267606928, rs267606929, rs1885090126, rs121434591, rs121912431, rs121912432, rs121912433, rs121912434, rs121912435, rs121912440, rs121912436, rs121912437, rs121912438, rs121912439, rs74315452, rs121912442, rs121912443, rs121912444, rs121912446, rs121912447, rs1197141604, rs121912448, rs121912449, rs121912450, rs121912451, rs121912452, rs121912453, rs121912454, rs369600566, rs121912455, rs121912456, rs121912457, rs121912458, rs1555836889, rs121909667, rs121909668, rs121909669, rs121909671, rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544, rs80356734, rs367543041, rs80356740, rs80356719, rs80356721, rs80356723, rs80356725, rs387906627, rs387906628, rs387906709, rs387906710, rs387906711, rs387906829, rs387907264, rs387907265, rs387907266, rs312262739, rs312262709, rs312262749, rs200793464, rs147713329, rs312262788, rs397514262, rs63751180, rs587777132, rs730880025, rs730880026, rs730880027, rs368743618, rs730880029, rs730882255, rs730882256, rs786205611, rs121912441, rs199947197, rs780136067, rs772731615, rs879253926, rs879254294, rs764717219, rs886041390, rs750159428, rs753207473, rs267607087, rs767350733, rs778305085, rs1554707680, rs1554707622, rs1393363759, rs750959420, rs1555509569, rs1554716504, rs11556620, rs1247392012, rs142083484, rs140385286, rs749428135, rs371575563, rs1402429085, rs1218712729, rs1555179091, rs1555179087, rs746971952, rs1555836950, rs368276916, rs140376902, rs747220413, rs76731700, rs770684782, rs1200906022, rs1804449, rs1482760341, rs769898852, rs140599944, rs757972700, rs1555451521, rs1592362719, rs1555836803, rs763455928, rs1378590183, rs1583695322, rs1362178149, rs1197928094, rs368751524, rs1555509609, rs1574787779, rs1601157750, rs1301635320, rs1341055534, rs1402092579, rs1568809172, rs1555836170, rs1315541036, rs1339283341, rs1643659556, rs1644506661, rs1435710212, rs1553122918, rs1689580631, rs374047961, rs775935265, rs2076486420, rs1820836522, rs757260058, rs1844420892, rs1833371664, rs1833438306, rs1833451208, rs2083790483, rs1303294230, rs1226110412, rs2053207945, rs2053208751, rs2053501632, rs2053539304, rs1567479067, rs544088874, rs1228194239, rs1568807400, rs1169198442, rs2049594204, rs2049594311, rs1568810641, rs1568811372, rs2049618449, rs1476760624, rs2079347087 |
22959728 |
Asthma |
Asthma |
rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 |
|
Bronchiectasis |
Bronchiectasis |
rs121908758, rs121908811, rs76649725, rs267606722, rs121909008, rs387906360, rs387906361, rs80034486, rs74767530, rs121908776, rs121909012, rs77646904, rs121908754, rs121909015, rs121909016, rs387906365, rs80055610, rs75528968, rs121908748, rs77932196, rs121909026, rs121908751, rs121908750, rs746418935, rs79282516, rs77409459, rs121909031, rs76554633, rs75115087, rs79633941, rs387906375, rs75389940, rs121909043, rs387906379, rs121908784, rs121909047, rs137852709, rs1596894031, rs137852710, rs61759860, rs121908805, rs193922501, rs193922503, rs193922504, rs1554389296, rs121908812, rs74467662, rs193922510, rs193922514, rs121908797, rs193922515, rs76151804, rs78984783, rs77035409, rs193922532, rs121908767, rs77188391, rs121908789, rs121908779, rs36210737, rs121908763, rs121908794, rs121908796, rs121908772, rs79031340, rs397508137, rs397508139, rs121908774, rs397508150, rs397508152, rs397508158, rs397508165, rs397508168, rs397508173, rs397508192, rs397508196, rs397508200, rs397508205, rs397508208, rs397508211, rs397508222, rs397508225, rs397508231, rs397508243, rs397508251, rs397508261, rs397508272, rs397508273, rs397508276, rs397508295, rs397508296, rs397508298, rs397508300, rs77284892, rs397508310, rs201978662, rs201124247, rs121908780, rs397508331, rs397508333, rs397508339, rs397508341, rs121908760, rs397508350, rs397508353, rs121908810, rs397508360, rs374946172, rs145449046, rs397508377, rs397508379, rs397508380, rs397508386, rs397508387, rs397508393, rs397508399, rs397508400, rs397508412, rs397508413, rs121909034, rs149790377, rs121908792, rs397508426, rs397508431, rs397508441, rs397508451, rs397508461, rs397508479, rs397508482, rs397508496, rs397508498, rs397508506, rs397508510, rs142394380, rs121909036, rs139304906, rs121908798, rs397508532, rs397508535, rs146521846, rs139729994, rs397508570, rs397508572, rs77834169, rs78655421, rs121908765, rs397508595, rs397508596, rs397508600, rs397508604, rs397508609, rs397508616, rs397508620, rs397508624, rs121908808, rs397508635, rs397508636, rs397508637, rs397508658, rs397508673, rs397508680, rs397508686, rs76371115, rs397508702, rs397508706, rs397508712, rs397508715, rs397508721, rs397508732, rs397508734, rs397508740, rs121908771, rs397508761, rs78440224, rs121908793, rs397508767, rs121908803, rs397508777, rs397508784, rs397508791, rs397508796, rs397508799, rs397508805, rs397508808, rs397508809, rs397508824, rs786204693, rs755416052, rs397508263, rs1057516619, rs397508176, rs1057516415, rs1057516970, rs754392413, rs1057516457, rs397508709, rs1060503164, rs775663783, rs397508294, rs1554380497, rs397508163, rs121908785, rs1235397597, rs397508405, rs1554392800, rs375661578, rs397508693, rs766063304, rs141482808, rs1290078234, rs756219310, rs1554390958, rs1555112332, rs750559671, rs533959068, rs1554389062, rs1554389486, rs1330431481, rs193922730, rs779177972, rs1562928997, rs1562908997, rs1562876459, rs1584785196, rs1584786454, rs1299250440, rs1584837090, rs1584764596, rs1584812425 |
|
Ciliary dyskinesia |
Primary Ciliary Dyskinesia, Ciliary Dyskinesia, Primary, 1, With Or Without Situs Inversus |
rs397515339, rs267607225, rs267607226, rs786205052, rs267607227, rs118204041, rs118204042, rs118204043, rs137853191, rs121434369, rs397515565, rs397515358, rs137852998, rs397515363, rs79833450, rs121908854, rs121908855, rs1554294478, rs79967166, rs121908853, rs1580543863, rs62642057, rs62638634, rs137852549, rs606231180, rs606231181, rs387907021, rs397515392, rs397515393, rs387907092, rs387907093, rs387907151, rs387907152, rs397515395, rs587776910, rs145457535, rs368260932, rs147718607, rs606231238, rs606231239, rs201133219, rs606231240, rs672601333, rs751785066, rs397514561, rs397515413, rs397515414, rs397515424, rs141945265, rs397515425, rs200321595, rs312262868, rs587776997, rs142371860, rs373501414, rs397515540, rs397515541, rs397515563, rs587778819, rs587778820, rs587778821, rs587778822, rs138815960, rs587777043, rs587777044, rs397515460, rs587777045, rs200913791, rs397515461, rs587777047, rs587777048, rs587777049, rs138320978, rs587777058, rs587777059, rs151107532, rs397518455, rs397518456, rs397515340, rs397515488, rs397515621, rs397515622, rs397518458, rs201740530, rs886037653, rs863223325, rs143740376, rs398122401, rs869320683, rs398122960, rs369037463, rs398123336, rs281865301, rs62635001, rs62635002, rs62653029, rs281865304, rs281865296, rs62635010, rs62635009, rs62635011, rs62635013, rs62650215, rs62638627, rs62638626, rs62638639, rs62638642, rs281865297, rs62650216, rs62638652, rs62638655, rs62640586, rs62640588, rs62640592, rs281865295, rs587777199, rs587777498, rs587777499, rs587777500, rs587777501, rs587777502, rs587777503, rs587777635, rs587777780, rs727502975, rs727502971, rs727504802, rs727502977, rs727504815, rs727503394, rs730882261, rs780175755, rs769054713, rs374909386, rs796052117, rs796052118, rs875989825, rs796052119, rs797045086, rs797045085, rs797044945, rs397515341, rs544674332, rs771663107, rs797045152, rs797045151, rs777031813, rs142800871, rs760123202, rs145742175, rs202094637, rs863224531, rs756235547, rs863224503, rs769458738, rs863224504, rs754867753, rs863224519, rs771214648, rs748688175, rs755553133, rs566755911, rs779506456, rs748618094, rs148891849, rs864622512, rs762664261, rs1060501460, rs753614861, rs72657316, rs200693106, rs876657683, rs876657637, rs752924362, rs750708201, rs878855279, rs773801386, rs878855280, rs571919972, rs755407407, rs775946081, rs755596256, rs878854458, rs878854457, rs762081081, rs144711161, rs878854441, rs72657321, rs757013900, rs878854444, rs878854445, rs878854446, rs72657393, rs878854435, rs878854436, rs1554294459, rs878855036, rs878854968, rs769284314, rs200669099, rs878855078, rs878855041, rs878855042, rs879253744, rs201213030, rs771920114, rs868755574, rs754776389, rs775700619, rs886037888, rs886037889, rs886039500, rs886039340, rs769346541, rs886041376, rs753101269, rs886042735, rs886044152, rs201943194, rs886044302, rs775696136, rs78484669, rs773498002, rs138890576, rs577069249, rs587621539, rs200901816, rs1060501456, rs773711154, rs752925056, rs1554020233, rs1060501464, rs769691189, rs767019228, rs1060501461, rs1060501467, rs1060501455, rs1060501459, rs1060501457, rs1060501466, rs1060501458, rs775051461, rs1060501454, rs781469274, rs759059925, rs766256391, rs1060503056, rs1060503063, rs1060503388, rs371374918, rs1060503107, rs144405450, rs752479330, rs1060503041, rs774903187, rs1060503104, rs763569711, rs1060503495, rs1060503515, rs752795172, rs1060501178, rs372572996, rs902156961, rs1060502829, rs1060503433, rs1060502202, rs200708870, rs775299709, rs370706991, rs141581673, rs774081599, rs757536895, rs756430359, rs770143722, rs1064792947, rs1060501861, rs1060500990, rs1060502831, rs372166228, rs1060501181, rs1060500123, rs772219642, rs1064795496, rs1064794014, rs575017579, rs1555354198, rs779490893, rs1555961832, rs1555961852, rs1555964133, rs768986129, rs1355068287, rs751845138, rs745800344, rs1553800956, rs1210953680, rs1007345781, rs1553805885, rs1553803540, rs1553804209, rs1553804640, rs746049858, rs1554049087, rs1554058577, rs1474945018, rs1554074565, rs753397685, rs754698253, rs1554033855, rs1353723750, rs763440781, rs367877988, rs747900131, rs749082955, rs1554062097, rs1554090622, rs1554090927, rs767716511, rs1554017211, rs753130398, rs745918507, rs1273352530, rs1354919632, rs368644722, rs1161303371, rs1283070426, rs755136231, rs1443540935, rs548521732, rs989235687, rs776686983, rs1554101045, rs116128702, rs1554132747, rs376576474, rs775136764, rs1034327724, rs902750903, rs750528020, rs753496815, rs771781357, rs1261703349, rs765025514, rs1554309352, rs1286036654, rs72657333, rs1554269295, rs373844629, rs767595964, rs1554293484, rs775720394, rs1212535211, rs1162526607, rs769637393, rs1554312483, rs1164659091, rs1275718084, rs202236144, rs972753865, rs147811057, rs1554248794, rs1554248887, rs950490534, rs1554291973, rs1275662909, rs1229952265, rs1554255966, rs1465404366, rs1409069267, rs1555174708, rs777108430, rs1555328022, rs1555328130, rs1555328047, rs758650222, rs1555526915, rs746242380, rs1555519999, rs762843285, rs758109864, rs1555614910, rs751191119, rs756868374, rs773796940, rs1555875358, rs556286752, rs1186608353, rs1555723797, rs745465871, rs773208371, rs745993158, rs1554082275, rs1555961677, rs1349668884, rs751610886, rs376496894, rs1554292398, rs1555327917, rs375053470, rs981267400, rs1555721837, rs769795916, rs1462578042, rs146412095, rs1553804220, rs1415346246, rs1553805740, rs1553804100, rs1275367324, rs886059965, rs1554081658, rs754982008, rs1554035330, rs1554050517, rs1554072027, rs756032160, rs77377082, rs79185772, rs775866092, rs1304504006, rs1193586811, rs1554082872, rs768881056, rs1554019966, rs1554247978, rs774393276, rs1554248617, rs766707325, rs756868889, rs1554249521, rs1437893220, rs770372463, rs749731714, rs1233811324, rs1554281038, rs757784023, rs551275210, rs750603177, rs769220870, rs1380083184, rs1554282583, rs763900107, rs769224534, rs747121305, rs1554822213, rs1555328087, rs1555327928, rs1233603821, rs745495583, rs1555527001, rs897911822, rs780116486, rs1421531868, rs746361802, rs1555968248, rs144037391, rs1305797678, rs1555071691, rs561237622, rs767760877, rs754773453, rs1555069023, rs372118787, rs774493427, rs1569237206, rs1560079213, rs1560086701, rs1560092440, rs1370489117, rs1561097225, rs914675446, rs748171209, rs1188507108, rs1561487416, rs1561073938, rs769691641, rs1561215953, rs1175877764, rs146087064, rs1561532139, rs574586008, rs1561117442, rs1444391928, rs145974361, rs1561836628, rs376903331, rs769929539, rs1436804091, rs1285431486, rs180897552, rs1562590250, rs1562684798, rs374107286, rs1562521048, rs1175443221, rs1563815206, rs753580394, rs1560090006, rs1560092160, rs778577109, rs1561122898, rs745885469, rs1561477725, rs757801770, rs1561524235, rs771956532, rs1391084505, rs769267893, rs1297857806, rs751920647, rs755782051, rs756616538, rs767713588, rs1297261096, rs768447289, rs374718437, rs1484826593, rs1561241156, rs769544175, rs565076112, rs1158185476, rs776176679, rs1562782355, rs1223799853, rs776791493, rs368248592, rs753649614, rs148810969, rs1346603171, rs371595543, rs1418585908, rs1567818236, rs761851970, rs748869874, rs766394527, rs753915759, rs1159887305, rs770403610, rs1240172375, rs764011276, rs770946088, rs764551914, rs1480671731, rs1568667609, rs1568709952, rs747233125, rs750658321, rs543369426, rs1569122408, rs1561449604, rs750649191, rs1564805053, rs1564805039, rs372959912, rs1564800859, rs577714887, rs766482965, rs1267599270, rs763238622, rs143007518, rs1567808990, rs969193071, rs867177356, rs1569162748, rs1561476089, rs377691013, rs1309805676, rs1569237077, rs1327282449, rs767308949, rs139416233, rs1567819753, rs1448501611, rs748600370, rs1601943268, rs750136163, rs1576941580, rs1256848235, rs747980515, rs1245822059, rs760742856, rs1579881985, rs762673561, rs1579942226, rs1579942510, rs1579980919, rs1580072662, rs369683202, rs1580150353, rs764948792, rs760595654, rs1580180757, rs1580203399, rs560398270, rs1309660408, rs981622980, rs1580363231, rs1580457416, rs767779749, rs116524991, rs1580543538, rs1580578744, rs1221785647, rs1252973555, rs1580809557, rs778780449, rs1164037667, rs1580853061, rs1580412021, rs1398588555, rs1561121987, rs753041231, rs748664881, rs1400425886, rs760122351, rs757935663, rs149070832, rs747123680, rs1582373132, rs1554149875, rs559143773, rs1583508118, rs949492765, rs1583567611, rs373946181, rs1237605731, rs756115857, rs1583806864, rs761855200, rs759332741, rs1489856215, rs201507046, rs1583517442, rs770251775, rs1586586381, rs369669370, rs1588663203, rs776979382, rs1003676784, rs1594608287, rs1489377964, rs1598330492, rs1598342751, rs755004291, rs1278589861, rs1277185772, rs763874734, rs753105954, rs373312648, rs369312501, rs1580179985, rs1580411207, rs1580465796, rs1579894454, rs1580143916, rs1582865345, rs200115379, rs372080325, rs1583570354, rs1583647043, rs72657354, rs767624733, rs1587089935, rs1587067513, rs1587091911, rs746849797, rs1598278059, rs1580731750, rs368110732, rs1597843267, rs1598348312, rs1217845018, rs1598372830, rs1598372841, rs1598372878, rs1598372791, rs1580402818, rs752527657, rs1601917999, rs1601922202, rs1601961064, rs1601982532, rs759302236, rs1597643228, rs1598293348, rs1601918140, rs745839898, rs1555961440, rs1601920423, rs907856232, rs281865302, rs1601972255, rs1601931052, rs1745570250, rs149368374, rs1601943325, rs1253689023, rs1575588483, rs1575215909, rs766982731, rs782603932, rs201244916, rs781864891, rs372955658, rs758482424, rs1601920532, rs1601924055, rs1601982474, rs1663812465, rs757823891, rs771057685, rs1711717951, rs1743041017, rs1744302993, rs1744309029, rs1744699899, rs1750171365, rs1750339039, rs1751962280, rs1752478598, rs1561215326, rs1264701182, rs1754234425, rs1465499923, rs1762460445, rs1762470883, rs148139814, rs760081822, rs1772369775, rs189080233, rs1778379197, rs1291689114, rs1176911729, rs769899297, rs1745583820, rs757303224, rs762267064, rs1416631904, rs749372718, rs72655998, rs756850884, rs765778415, rs1479385947, rs72658823, rs1162823375, rs370565524, rs746849639, rs973819096, rs1818211696, rs979934112, rs772133192, rs2051792816, rs2053367000, rs1567876609, rs2038617610, rs2085791151, rs770306950, rs2067876063, rs1468349011, rs1815572053, rs1268770869, rs1360420006, rs1772232595, rs774855011, rs1785786687, rs1788083949, rs2051550027, rs2037540861, rs753831132, rs937290981, rs766759197, rs1336208372, rs2067115815, rs866524368, rs1186795749, rs2067127718, rs1569235565, rs2067140471, rs2067144007, rs2067146007, rs2067157388, rs2067160273, rs2067161139, rs2067163605, rs2067164096, rs2067169934, rs2067172824, rs2067174697, rs1233849070, rs2067182354, rs2067182636, rs2067184023, rs2067187127, rs2067187618, rs2067188031, rs2067191335, rs2067193056, rs2067194648, rs2067406342, rs2067451355, rs2067700774, rs2067878321, rs2067878443, rs1718119792, rs1704217868, rs1704650728, rs1273109738, rs1768634470, rs1769225531, rs1298746949, rs1784195520, rs1788086604, rs1789346276, rs2058179740, rs2038565518, rs781949585, rs2038760864, rs1718195095, rs1783569129, rs1739374011, rs2082305577, rs2067148119, rs2067166789, rs2067172385, rs2067179633, rs2067200470, rs2067498092, rs771953930 |
28543983 |
Corneal dystrophy |
Corneal dystrophy |
rs121909212, rs121909214, rs760714959, rs766305306, rs1554579819, rs1554579832, rs1554579878 |
|
Gastrointestinal stromal tumor |
Gastrointestinal Stromal Tumors, Gastrointestinal Stromal Sarcoma |
rs587776653, rs74315368, rs74315369, rs587776793, rs587776794, rs587776795, rs606231209, rs121908589, rs121913685, rs121913680, rs794726675, rs587776804, rs121913517, rs121913234, rs121913512, rs267607032, rs387906780, rs201286421, rs587778661, rs587781270, rs587782243, rs74315370, rs587782703, rs786203457, rs764575966, rs786203251, rs587782604, rs200245469, rs397516836, rs786202732, rs786201161, rs786201063, rs751000085, rs869025568, rs876660642, rs876658713, rs151170408, rs878854632, rs752360961, rs121913235, rs121913521, rs121913513, rs1057519708, rs1057519710, rs121913514, rs1057519713, rs778582853, rs1060503757, rs1060502521, rs1060502543, rs898854295, rs981049067, rs916516745, rs1553887262, rs1057520032, rs1553887960, rs775143272, rs1560395607, rs1560418178, rs751904543, rs1560420761, rs1560417385, rs1560417396, rs1560417427, rs1560417438, rs1560417535, rs1560417642, rs1560417666, rs1560417673, rs1577992594, rs1577995761, rs1578003055, rs1301704156, rs1734957331 |
27793025 |
Hearing loss |
Conductive hearing loss |
rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359, rs180177151, rs180177154, rs180177153, rs35689081, rs35887622, rs80338944, rs104894396, rs104894398, rs80338947, rs80338948, rs80338942, rs104894402, rs104894403, rs80338945, rs28931594, rs80338940, rs80338941, rs80356590, rs80338950, rs387906706, rs387906707, rs387906708, rs398122848, rs387907016, rs587776894, rs387907088, rs397515411, rs370965183, rs398122930, rs199897298, rs111033187, rs111033448, rs199606180, rs111033284, rs397516413, rs111033305, rs111033220, rs111033256, rs111033297, rs111033253, rs104894408, rs111033295, rs397516874, rs76434661, rs111033335, rs397517323, rs111033247, rs367928692, rs374793617, rs143939430, rs397515605, rs80338939, rs200656442, rs779748859, rs587781261, rs587781262, rs143343083, rs200147906, rs730880338, rs797044491, rs146281367, rs756484720, rs869025593, rs201306709, rs540895576, rs777777359, rs879255246, rs1554358720, rs142498437, rs377145777, rs1057517519, rs779077039, rs952741388, rs1060499797, rs764139009, rs1060499590, rs1064794012, rs1064797115, rs756790858, rs775633137, rs1554952443, rs1554952193, rs782063761, rs1199012623, rs756147087, rs1555648043, rs1555661490, rs1553196233, rs781546107, rs111033190, rs775428246, rs782539587, rs537227442, rs148695069, rs1554835827, rs953422571, rs1554834186, rs1554834161, rs1554835103, rs1554577339, rs1554577402, rs768471577, rs782279338, rs781951909, rs998045226, rs375759781, rs755804651, rs1557458426, rs767797828, rs538027448, rs1559366084, rs367688416, rs1558480402, rs1558490542, rs1559870857, rs1560690591, rs1561299289, rs1562817224, rs1562817529, rs1562822565, rs1562835391, rs1564113368, rs1564554255, rs773851192, rs1564555240, rs761261855, rs1564805114, rs1565522273, rs1565127413, rs781790246, rs1565430886, rs1565469959, rs746667217, rs1565819402, rs1565855932, rs150529554, rs1567939793, rs201866631, rs754472294, rs1559372512, rs1558464965, rs1558488902, rs775062249, rs1226171550, rs1561590396, rs765574676, rs762876554, rs757327146, rs1564949059, rs1565519673, rs368050948, rs1565541888, rs781989117, rs1565402473, rs750358148, rs1386887007, rs1209665716, rs1567641234, rs1237955948, rs1569042782, rs752672077, rs146689036, rs1560070780, rs149712664, rs1564556995, rs762226905, rs773573968, rs1568528171, rs1198256157, rs377267777, rs370564476, rs1577876794, rs747787770, rs759432278, rs1043716893, rs1581138934, rs2033773650, rs1421964916, rs771766431, rs780917129, rs1895773215, rs1895769400, rs761543680, rs1565920060 |
|
Hydrocephalus |
Hydrocephalus |
rs387907320, rs369384363, rs387907321, rs372127610, rs770273135, rs797045095, rs797045707, rs769795916, rs781251438, rs922703465, rs376078512, rs1567043467, rs1587149916, rs1586841546 |
|
Kartagener syndrome |
Kartagener Syndrome, Polynesian Bronchiectasis |
rs397515339, rs267607227, rs137853191, rs397515363, rs606231164, rs79833450, rs606231165, rs387907021, rs147718607, rs397515563, rs138815960, rs587777047, rs138320978, rs587777059, rs151107532, rs201740530, rs869320683, rs587777780, rs587778819, rs397515341, rs544674332, rs771663107, rs760123202, rs876657683, rs769284314, rs200669099, rs1060503515, rs773208371, rs745993158, rs1554082275, rs751920647, rs368248592 |
28543983 |
Scoliosis |
Scoliosis, unspecified |
rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085 |
|
Situs inversus |
Situs inversus totalis |
rs528302390, rs1596264554 |
|
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Asthenozoospermia |
Asthenozoospermia |
|
|
Asplenia |
Congenital absence of spleen |
|
|
Congenital pectus excavatum |
Congenital pectus excavatum |
|
|
Bronchitis |
Bronchitis, Chronic |
|
|
Lung diseases |
Lung Diseases, Obstructive |
|
|
Nasal polyposis |
Nasal Polyps |
|
|
Otitis media |
Otitis Media with Effusion, Chronic otitis media |
rs601338, rs1047781, rs1800028 |
|
Ovarian serous adenocarcinoma |
Ovarian Serous Adenocarcinoma |
|
|
Rhinitis |
Rhinitis |
|
|
Sinusitis |
Chronic sinusitis |
|
|
|
|
|