DKK2 (dickkopf Wnt signaling pathway inhibitor 2)

Gene

• Entrez ID: 27123
• Gene name: Dickkopf Wnt signaling pathway inhibitor 2
• Gene symbol: DKK2
• Synonyms: DKK-2
• Chromosome: 4
• Chromosome location: 4q25
• Summary: This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007048	hsa-miR-218-5p	Luciferase reporter assay	23060446
MIRT018639	hsa-miR-335-5p	Microarray	18185580
MIRT003362	hsa-miR-221-3p	Reporter assay;Microarray	20018759
MIRT053325	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	23587485
MIRT053327	hsa-miR-1260b	Luciferase reporter assay, qRT-PCR, Western blot	23591200
MIRT007048	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	24091133
MIRT731607	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26656471
MIRT731607	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26656471
MIRT003362	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	27501171
MIRT736035	hsa-miR-203a-3p	Luciferase reporter assay, Western blotting	31489578
MIRT937664	hsa-miR-141	CLIP-seq
MIRT937665	hsa-miR-200a	CLIP-seq
MIRT937666	hsa-miR-204	CLIP-seq
MIRT937667	hsa-miR-211	CLIP-seq
MIRT937668	hsa-miR-2113	CLIP-seq
MIRT937669	hsa-miR-217	CLIP-seq
MIRT937670	hsa-miR-298	CLIP-seq
MIRT937671	hsa-miR-3064-5p	CLIP-seq
MIRT937672	hsa-miR-3187-3p	CLIP-seq
MIRT937673	hsa-miR-3678-3p	CLIP-seq
MIRT937674	hsa-miR-3688-3p	CLIP-seq
MIRT937675	hsa-miR-369-3p	CLIP-seq
MIRT937676	hsa-miR-374a	CLIP-seq
MIRT937677	hsa-miR-374b	CLIP-seq
MIRT937678	hsa-miR-4261	CLIP-seq
MIRT937679	hsa-miR-4287	CLIP-seq
MIRT937680	hsa-miR-4469	CLIP-seq
MIRT937681	hsa-miR-450b-5p	CLIP-seq
MIRT937682	hsa-miR-4529-5p	CLIP-seq
MIRT937683	hsa-miR-4685-3p	CLIP-seq
MIRT937684	hsa-miR-4793-3p	CLIP-seq
MIRT937685	hsa-miR-507	CLIP-seq
MIRT937686	hsa-miR-557	CLIP-seq
MIRT937687	hsa-miR-604	CLIP-seq
MIRT937688	hsa-miR-647	CLIP-seq
MIRT937689	hsa-miR-758	CLIP-seq
MIRT937690	hsa-miR-892b	CLIP-seq
MIRT937691	hsa-miR-944	CLIP-seq
MIRT1977560	hsa-miR-1252	CLIP-seq
MIRT1977561	hsa-miR-4496	CLIP-seq
MIRT1977562	hsa-miR-4652-3p	CLIP-seq
MIRT1977563	hsa-miR-545	CLIP-seq
MIRT937666	hsa-miR-204	CLIP-seq
MIRT937667	hsa-miR-211	CLIP-seq
MIRT937668	hsa-miR-2113	CLIP-seq
MIRT2212831	hsa-miR-3194-3p	CLIP-seq
MIRT2212832	hsa-miR-3647-3p	CLIP-seq
MIRT937674	hsa-miR-3688-3p	CLIP-seq
MIRT937678	hsa-miR-4261	CLIP-seq
MIRT937679	hsa-miR-4287	CLIP-seq
MIRT937680	hsa-miR-4469	CLIP-seq
MIRT937683	hsa-miR-4685-3p	CLIP-seq
MIRT2212833	hsa-miR-4713-5p	CLIP-seq
MIRT937689	hsa-miR-758	CLIP-seq
MIRT2212834	hsa-miR-767-3p	CLIP-seq
MIRT2516665	hsa-miR-1206	CLIP-seq
MIRT2516666	hsa-miR-153	CLIP-seq
MIRT937666	hsa-miR-204	CLIP-seq
MIRT937667	hsa-miR-211	CLIP-seq
MIRT2516667	hsa-miR-342-3p	CLIP-seq
MIRT2516668	hsa-miR-3618	CLIP-seq
MIRT2516669	hsa-miR-4277	CLIP-seq
MIRT937679	hsa-miR-4287	CLIP-seq
MIRT2516670	hsa-miR-4307	CLIP-seq
MIRT2516671	hsa-miR-4452	CLIP-seq
MIRT937680	hsa-miR-4469	CLIP-seq
MIRT2516672	hsa-miR-4680-3p	CLIP-seq
MIRT937683	hsa-miR-4685-3p	CLIP-seq
MIRT2516673	hsa-miR-4700-3p	CLIP-seq
MIRT2212833	hsa-miR-4713-5p	CLIP-seq
MIRT2516674	hsa-miR-4760-3p	CLIP-seq
MIRT2516675	hsa-miR-548p	CLIP-seq
MIRT2516676	hsa-miR-576-5p	CLIP-seq
MIRT2516677	hsa-miR-656	CLIP-seq
MIRT2516678	hsa-miR-660	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	11742004
GO:0007275	Process	Multicellular organism development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0039706	Function	Co-receptor binding	IBA	21873635
GO:0048019	Function	Receptor antagonist activity	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11742004
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	23587485
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	NAS	24431302
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	12857724
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	NAS	24431302
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA

Other IDs

• MIM: 605415
• HGNC: 2892
• e!Ensembl: ENSG00000155011

Protein

• UniProt ID: Q9UBU2
• Protein name: Dickkopf-related protein 2 (Dickkopf-2) (Dkk-2) (hDkk-2)
• Protein function: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04706	Dickkopf_N	77 → 128	Dickkopf N-terminal cysteine-rich region	Family

• Sequence:

  MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQG
  LAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPST
  RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEG
  DPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
  VWKDATYSSKARLHVCQKI

• Sequence length: 259

Pathways

KEGG:

Wnt signaling pathway
Alzheimer disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Negative regulation of TCF-dependent signaling by WNT ligand antagonists
Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Alopecia	Alopecia		28196072
Alopecia, male pattern	Alopecia, Male Pattern		27182965
Androgenetic alopecia	Androgenetic Alopecia, Alopecia, Androgenetic, 3, Alopecia, Androgenetic, 2, Alopecia, Androgenetic, 1		27182965