GediPNet logo

GJA3 (gap junction protein alpha 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2700
Gene nameGene Name - the full gene name approved by the HGNC.
Gap junction protein alpha 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
GJA3
SynonymsGene synonyms aliases
CTRCT14, CX46, CZP3
ChromosomeChromosome number
13
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q12.11
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010]
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121917823 T>C Pathogenic Missense variant, coding sequence variant
rs121917825 G>A Pathogenic Missense variant, coding sequence variant
rs121917827 C>T Pathogenic Missense variant, coding sequence variant
rs140332366 T>A,C,G Pathogenic Missense variant, coding sequence variant
rs397514703 C>T Pathogenic Coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045585 hsa-miR-149-5p CLASH 23622248
MIRT1019627 hsa-miR-106a CLIP-seq
MIRT1019628 hsa-miR-106b CLIP-seq
MIRT1019629 hsa-miR-1245 CLIP-seq
MIRT1019630 hsa-miR-1256 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005243 Function Gap junction channel activity IBA 21873635
GO:0005887 Component Integral component of plasma membrane IDA 30044662
GO:0005922 Component Connexin complex IBA 21873635
GO:0005922 Component Connexin complex IDA 30044662
GO:0007267 Process Cell-cell signaling IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9Y6H8
Protein name Gap junction alpha-3 protein (Connexin-46) (Cx46)
Protein function Structural component of lens fiber gap junctions (PubMed:30044662). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells (By similarity). They are formed by the docking of two hexameric hemichannels, one from each
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00029 Connexin
3 227
Connexin
Family
Sequence
MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPG
CENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESP
SPKEPPQDNPSSRDDRGRVRMAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFELKPLYR
CDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHLGW
KKLKQGVTSRLGP
DASEAPLGTADPPPLPPSSRPPAVAIGFPPYYAHTAAPLGQARAVGYPGAPPPAADFKLL
ALTEARGKGQSAKLYNGHHHLLMTEQNWANQAAERQPPALKAYPAASTPAAPSPVGSSSP
PLAHEAEAGAAPLLLDGSGSSLEGSALAGTPEEEEQAVTTAAQMHQPPLPLGDPGRASKA
SRASSGRARPEDLAI
Sequence length 435
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Gap junction assembly
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Cataract Nuclear cataract, Nuclear non-senile cataract, Cataract, Pulverulent, CATARACT, COPPOCK-LIKE, CATARACT, MARNER TYPE, Cataract, Zonular Pulverulent 3, Early-onset nuclear cataract, Early-onset posterior polar cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322, rs121917775, rs121917735, rs121917736, rs137853199, rs137853200, rs121917867, rs121917869, rs121913555, rs104893736, rs121909595, rs121909596, rs121909597, rs28931605, rs121909598, rs104893618, rs1695062782, rs74315486, rs74315487, rs74315490, rs74315489, rs745938679, rs1566402656, rs74315439, rs74315441, rs121912973, rs121917823, rs1593332981, rs121917825, rs121917827, rs113994108, rs387906963, rs387906964, rs1240503246, rs387906965, rs387906966, rs750207077, rs387907336, rs387907337, rs387907342, rs140332366, rs397514703, rs398122937, rs398122378, rs398122392, rs398122944, rs137853924, rs398122947, rs397515623, rs397515624, rs397515625, rs397515626, rs398122948, rs587778872, rs398123066, rs587777601, rs370424081, rs786205221, rs786205222, rs864309684, rs864309688, rs864309701, rs864309689, rs864309690, rs864309681, rs864309686, rs864309696, rs864309693, rs864309687, rs864309691, rs864309692, rs864309695, rs864309678, rs864309685, rs864309700, rs864309698, rs864309683, rs864309682, rs864309679, rs111534978, rs864309680, rs864309702, rs864622780, rs756898971, rs869312732, rs775038545, rs878852983, rs1114167312, rs1114167313, rs1114167314, rs1114167315, rs1114167307, rs886041410, rs886041412, rs1057518738, rs1057517926, rs1057518878, rs1057519616, rs12799308, rs1064793935, rs1064797219, rs1085307126, rs1085307127, rs765628635, rs1114167427, rs1114167433, rs1554744860, rs1554743428, rs747093432, rs1411557416, rs1555179713, rs1481963503, rs1555549755, rs1456161420, rs1555547008, rs1555889308, rs1555888762, rs766522434, rs1264025914, rs1553585262, rs1567671947, rs1337897299, rs764945940, rs1307969607, rs949335475, rs1184095219, rs776129797, rs1569203234, rs1567668570, rs749141857, rs764098604, rs1184398243, rs1578956689, rs1568480054, rs1564745688, rs1564722302, rs1564723150, rs1571175950, rs1569602837, rs1576552712, rs1575369255, rs981126461, rs1570403798, rs200557771, rs1477743112, rs1651879427, rs1651881222, rs1651919374, rs2024441691, rs148284531, rs1246080692 16234473, 21552498, 20431721, 20431721, 21552498, 16234473, 22876138, 20431721, 21681855, 15286166, 16971895, 21552498, 24772942, 26683566, 16254549, 22312188, 15448617, 15208569, 25635993, 21647269, 14627959, 30044662, 10746562, 16234473, 10205266, 17893674, 17615540, 21897748, 16885921
Unknown
Disease name Disease term dbSNP ID References
Capsular cataract Posterior subcapsular cataract 21031021
Congenital cataract Congenital cataract, Congenital lamellar cataract 26694549
Pulverulent cataract Pulverulent cataract

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412