GIP (gastric inhibitory polypeptide)

Gene

• Entrez ID: 2695
• Gene name: Gastric inhibitory polypeptide
• Gene symbol: GIP
• Synonyms: -
• Chromosome: 17
• Chromosome location: 17q21.32
• Summary: This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018333	hsa-miR-335-5p	Microarray	18185580
MIRT021426	hsa-miR-9-5p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	17715056, 25416956, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007165	Process	Signal transduction	TAS	2890159
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007565	Process	Female pregnancy	IEA
GO:0007613	Process	Memory	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0010447	Process	Response to acidic pH	IEA
GO:0010828	Process	Positive regulation of glucose transmembrane transport	IEA
GO:0014070	Process	Response to organic cyclic compound	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0031769	Function	Glucagon receptor binding	IBA	21873635
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0033993	Process	Response to lipid	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035640	Process	Exploration behavior	IEA
GO:0042304	Process	Regulation of fatty acid biosynthetic process	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042594	Process	Response to starvation	IBA	21873635
GO:0043025	Component	Neuronal cell body	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043950	Process	Positive regulation of cAMP-mediated signaling	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS	20081857
GO:0055123	Process	Digestive system development	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0070094	Process	Positive regulation of glucagon secretion	IEA
GO:0070328	Process	Triglyceride homeostasis	IEA

Other IDs

• MIM: 137240
• HGNC: 4270
• e!Ensembl: ENSG00000159224

Protein

• UniProt ID: P09681
• Protein name: Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) (Incretin hormone)
• Protein function: Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
• PDB: 1T5Q, 2B4N, 2L70, 2L71, 2OBU, 2QKH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00123	Hormone_2	52 → 79	Peptide hormone	Family

• Sequence:

  MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
  YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
  KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR

• Sequence length: 153

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Insulin secretion

Reactome:

Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778

Unknown
Disease name	Disease term	dbSNP ID	References
Anorexia	Anorexia		29689362, 28633506, 28666375