GediPNet logo

HAVCR1 (hepatitis A virus cellular receptor 1)
Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26762
Gene nameGene Name - the full gene name approved by the HGNC.
Hepatitis A virus cellular receptor 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
HAVCR1
SynonymsGene synonyms aliases
CD365, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1
ChromosomeChromosome number
5
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.3
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. [provided by RefSeq, Apr 2015]
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT018340 hsa-miR-335-5p Microarray 18185580
MIRT019312 hsa-miR-148b-3p Microarray 17612493
MIRT441440 hsa-miR-4668-5p PAR-CLIP 22100165
MIRT441441 hsa-miR-4699-3p PAR-CLIP 22100165
MIRT441442 hsa-miR-944 PAR-CLIP 22100165
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IBA 21873635
GO:0001618 Function Virus receptor activity IDA 21536871
GO:0001786 Function Phosphatidylserine binding IBA 21873635
GO:0006911 Process Phagocytosis, engulfment IBA 21873635
GO:0009986 Component Cell surface IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96D42
Protein name Hepatitis A virus cellular receptor 1 (HAVcr-1) (Kidney injury molecule 1) (KIM-1) (T-cell immunoglobulin and mucin domain-containing protein 1) (TIMD-1) (T-cell immunoglobulin mucin receptor 1) (TIM) (TIM-1) (T-cell membrane protein 1) (CD antigen CD365)
Protein function May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. ; (Microbial infection) Acts as a receptor for Hepatitis A virus. ; (Microbial infection) Acts as a receptor for Ebolavirus and Marburg virus by binding exposed phosphatidyl-serine at the surface of virion membrane (PubMed:21536871). Serves as a dual receptor for Ebolavirus by also interacting with envelope glycoprotein GP (PubMed:26487564). ; (Microbial infection) Acts as a receptor for Dengue virus by binding exposed phosphatidyl-serine at the surface of virion membrane. ; (Microbial infection) Acts as a receptor for Zika virus by binding to envelope protein E.
PDB 5DZO , 5F70
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set
20 → 124
Immunoglobulin V-set domain
 Domain
Sequence 
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNG
IVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV
SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLT
TMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPT
TLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGIYAGV
CISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSL
YATD
Sequence length 364
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
  Virion - Flavivirus and Alphavirus
Efferocytosis 		 
Associated diseases
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Common variable immunodeficiency Common Variable Immunodeficiency rs-1, rs72553883, rs121908379, rs104894650, rs587776775, rs398122863, rs398122864, rs397514332, rs397514331, rs727502786, rs727502787, rs72553882, rs869320688, rs869320689, rs869320754, rs773694113, rs1553319504, rs201017642, rs1555550717, rs1558192723, rs1030733127, rs749636258, rs185689791, rs1559035937, rs1565214594, rs1560679469, rs1560711146, rs1569376229, rs1578790573, rs939459600, rs1572952530, rs1572950925, rs772481080, rs369363360, rs72553885, rs72553879, rs1265262160, rs1303637368, rs757598952, rs1016142312, rs1578771120, rs1578771197, rs1578793298, rs1578793312, rs1578809101, rs1578811073, rs1590715754, rs144718007, rs759649059, rs1723945421, rs2061279365 21497890
Kidney disease Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315 21888673, 24880025, 20438795, 20181666, 23019274, 24863737, 19349640
Unknown
Disease name Disease term dbSNP ID References
Glomerular hyalinosis Hyalinosis, Segmental Glomerular 19225054
Glomerulosclerosis Focal glomerulosclerosis 19225054
Kidney failure Kidney Failure, Acute 20118187, 28885000, 24958931, 22005293, 23052191, 23845967, 24361871, 21835770, 24189134, 21259293
Acute kidney insufficiency Acute Kidney Insufficiency 28885000, 22005293, 21259293, 20118187, 23845967, 21835770, 24189134, 24361871, 23052191, 24958931

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412