GFRA3 (GDNF family receptor alpha 3)

Gene

• Entrez ID: 2676
• Gene name: GDNF family receptor alpha 3
• Gene symbol: GFRA3
• Synonyms: GDNFR3
• Chromosome: 5
• Chromosome location: 5q31.2
• Summary: The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. [provided

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT2234439	hsa-miR-1270	CLIP-seq
MIRT2234440	hsa-miR-1273f	CLIP-seq
MIRT2234441	hsa-miR-224	CLIP-seq
MIRT2234442	hsa-miR-342-5p	CLIP-seq
MIRT2234443	hsa-miR-4651	CLIP-seq
MIRT2234444	hsa-miR-4664-5p	CLIP-seq
MIRT2234445	hsa-miR-4683	CLIP-seq
MIRT2234446	hsa-miR-4795-5p	CLIP-seq
MIRT2234447	hsa-miR-608	CLIP-seq
MIRT2234448	hsa-miR-620	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001764	Process	Neuron migration	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9407096
GO:0005515	Function	Protein binding	IPI	16765900
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	9490034, 9576965
GO:0007399	Process	Nervous system development	IBA	21873635
GO:0007411	Process	Axon guidance	TAS
GO:0007422	Process	Peripheral nervous system development	TAS	9576965
GO:0008046	Function	Axon guidance receptor activity	IEA
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016167	Function	Glial cell-derived neurotrophic factor receptor activity	IBA	21873635
GO:0019898	Component	Extrinsic component of membrane	TAS	9490034
GO:0031225	Component	Anchored component of membrane	IEA
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IEA
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0048485	Process	Sympathetic nervous system development	IEA

Other IDs

• MIM: 605710
• HGNC: 4245
• e!Ensembl: ENSG00000146013

Protein

• UniProt ID: O60609
• Protein name: GDNF family receptor alpha-3 (GDNF receptor alpha-3) (GDNFR-alpha-3) (GFR-alpha-3)
• Protein function: Receptor for artemin (ARTN), a growth factor that supports the survival of sensory and sympathetic peripheral neurons (PubMed:31535977, PubMed:9883723). ARTN-binding leads to autophosphorylation and activation of the RET receptor (PubMed:3153597
• PDB: 2GH0, 6Q2S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02351	GDNF	44 → 125	GDNF/GAS1 domain	Domain
  PF02351	GDNF	162 → 239	GDNF/GAS1 domain	Domain
  PF02351	GDNF	248 → 340	GDNF/GAS1 domain	Domain

• Sequence:

  MVRPLNPRPLPPVVLMLLLLLPPSPLPLAAGDPLPTESRLMNSCLQARRKCQADPTCSAA
  YHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTV
  HRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRK
  AYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCA
  LPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAM
  TPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDW
  PHPTFAVMAHQNENPAVRPQPWVPSLFSCTLPLILLLSLW

• Sequence length: 400

Pathways

Reactome:

RAF/MAP kinase cascade
RET signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20116071