GediPNet logo

DAOA (D-amino acid oxidase activator)
Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
267012
Gene nameGene Name - the full gene name approved by the HGNC.
D-amino acid oxidase activator
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
DAOA
SynonymsGene synonyms aliases
LG72, SG72
ChromosomeChromosome number
13
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q33.2|13q34
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors. Studies also suggest that one encoded isoform m
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IDA 21679769
GO:0005794 Component Golgi apparatus IDA 12364586
GO:0008047 Function Enzyme activator activity IDA 12364586
GO:0019899 Function Enzyme binding IPI 12364586, 20521334, 21679769
GO:0043085 Process Positive regulation of catalytic activity IDA 12364586
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID P59103
Protein name D-amino acid oxidase regulator (Protein G72)
Protein function May suppress DAO (D-amino acid oxidase) and SOD1 activity and promote their degradation (PubMed:18544534, PubMed:20521334, PubMed:21679769, PubMed:30037290). Has conversely also been suggested to function as a DAO activator (PubMed:12364586, Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15199 DAOA
72 → 153
D-amino acid oxidase activator
 Family
Sequence 
MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEG
WKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASK
DRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE
Sequence length 153
Interactions View interactions
Associated diseases
Gene Gene ontology Other IDs Protein Associated diseases
Causal
Disease name Disease term dbSNP ID References
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313
Unknown
Disease name Disease term dbSNP ID References
Affective psychosis Affective Disorders, Psychotic 20005295, 20667145
Bipolar disorder Bipolar Disorder 24447945, 22429365, 22438288, 23861766, 20957330
Delusions Delusions
Hallucinations Hallucinations

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412