GediPNet logo

GDNF (glial cell derived neurotrophic factor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2668
Gene nameGene Name - the full gene name approved by the HGNC.
Glial cell derived neurotrophic factor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
GDNF
SynonymsGene synonyms aliases
ATF, ATF1, ATF2, HFB1-GDNF, HSCR3
ChromosomeChromosome number
5
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs36119840 G>A Pathogenic, risk-factor, likely-benign Coding sequence variant, missense variant
rs104893891 T>A,C Risk-factor Coding sequence variant, missense variant
rs121918536 G>C Risk-factor Coding sequence variant, missense variant
rs375385439 C>A,T Conflicting-interpretations-of-pathogenicity Intron variant, coding sequence variant, synonymous variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019438 hsa-miR-148b-3p Microarray 17612493
MIRT022032 hsa-miR-128-3p Microarray 17612493
MIRT025911 hsa-miR-7-5p Microarray 17612493
MIRT630717 hsa-miR-3129-3p HITS-CLIP 23824327
MIRT630716 hsa-miR-5583-5p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
EGR1 Unknown 9729303
NFKB1 Unknown 9729303
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0001656 Process Metanephros development ISS
GO:0001658 Process Branching involved in ureteric bud morphogenesis ISS
GO:0001755 Process Neural crest cell migration IDA 15242795
GO:0001759 Process Organ induction IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P39905
Protein name Glial cell line-derived neurotrophic factor (hGDNF) (Astrocyte-derived trophic factor) (ATF)
Protein function Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake (PubMed:8493557). Acts by binding to its coreceptor, GFRA1, leading to autophosphorylation and
PDB 2V5E , 3FUB , 4UX8 , 6Q2N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta
117 210
Transforming growth factor beta like domain
Domain
Sequence
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ
FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL
TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR
PIAFDDDLSFLDDNLVYHILRKHSAKRCGC
I
Sequence length 211
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
  RAF/MAP kinase cascade
RET signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anaplastic oligodendroglioma Anaplastic Oligodendroglioma rs1568504941 19138852
Congenital central hypoventilation Congenital central hypoventilation rs587776626, rs1733878065, rs761018157, rs779557320, rs772448418, rs775006915, rs1733941453, rs73810366 9497256
Ependymoma Cellular Ependymoma, Ependymoma rs1555165565, rs1555993293 19138852
Glioblastoma Glioblastoma, Glioblastoma Multiforme rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888 19138852
Unknown
Disease name Disease term dbSNP ID References
Akinetic-rigid variant of huntington disease Akinetic-Rigid Variant of Huntington Disease 16943855
Anaplastic ependymoma Anaplastic Ependymoma rs147045425, rs200431130, rs765980348 19138852
Atherosclerotic parkinsonism Atherosclerotic Parkinsonism 19909981
Bipolar disorder Bipolar Disorder 18313696, 24997227

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412