GediPNet logo

RGS17 (regulator of G protein signaling 17)
Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26575
Gene nameGene Name - the full gene name approved by the HGNC.
Regulator of G protein signaling 17
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
RGS17
SynonymsGene synonyms aliases
RGS-17, RGSZ2, hRGS17
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT024057 hsa-miR-1-3p Microarray 18668037
MIRT028374 hsa-miR-32-5p Sequencing 20371350
MIRT671793 hsa-miR-562 HITS-CLIP 23824327
MIRT671792 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT671791 hsa-miR-6877-3p HITS-CLIP 23824327
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0001975 Process Response to amphetamine IEA
GO:0003924 Function GTPase activity TAS
GO:0005096 Function GTPase activator activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UGC6
Protein name Regulator of G-protein signaling 17 (RGS17)
Protein function Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, ther
PDB 1ZV4 , 6AM3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS
84 → 199
Regulator of G protein signaling domain
 Domain
Sequence 
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
Sequence length 210
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
Reactome
    G alpha (q) signalling events
G alpha (i) signalling events
G alpha (z) signalling events
Associated diseases
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Prostate cancer Malignant neoplasm of prostate, Prostate carcinoma rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 23535732, 23535732, 29892016

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412