NUPR1 (nuclear protein 1, transcriptional regulator)

Gene

• Entrez ID: 26471
• Gene name: Nuclear protein 1, transcriptional regulator
• Gene symbol: NUPR1
• Synonyms: COM1, P8
• Chromosome: 16
• Chromosome location: 16p11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018204	hsa-miR-335-5p	Microarray	18185580
MIRT022819	hsa-miR-124-3p	Microarray	18668037
MIRT040412	hsa-miR-615-3p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	19946894

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002526	Process	Acute inflammatory response	IEA
GO:0003677	Function	DNA binding	IDA	11056169, 18690848
GO:0003682	Function	Chromatin binding	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	11940591
GO:0005515	Function	Protein binding	IPI	11940591, 16300740, 16478804, 18690848, 19723804, 20181828, 28720707, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	10092851, 16300740
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16300740
GO:0006473	Process	Protein acetylation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IBA	21873635
GO:0008584	Process	Male gonad development	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010506	Process	Regulation of autophagy	ISS
GO:0010507	Process	Negative regulation of autophagy	IMP	20181828
GO:0010507	Process	Negative regulation of autophagy	ISS
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IMP	20181828
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	ISS
GO:0010698	Function	Acetyltransferase activator activity	ISS
GO:0031401	Process	Positive regulation of protein modification process	IEA
GO:0032993	Component	Protein-DNA complex	IDA	11056169
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16478804, 30451898
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	20181828
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	ISS
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0045171	Component	Intercellular bridge	IDA
GO:0045786	Process	Negative regulation of cell cycle	IBA	21873635
GO:0045786	Process	Negative regulation of cell cycle	IMP	19723804
GO:0045787	Process	Positive regulation of cell cycle	IDA	10092851
GO:0045820	Process	Negative regulation of glycolytic process	IMP	30451898
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16300740
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0062099	Process	Negative regulation of programmed necrotic cell death	IMP	30451898
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IMP	16300740
GO:1902902	Process	Negative regulation of autophagosome assembly	IMP	20181828
GO:1903862	Process	Positive regulation of oxidative phosphorylation	IMP	30451898
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	ISS
GO:1904691	Process	Negative regulation of type B pancreatic cell proliferation	ISS
GO:1905897	Process	Regulation of response to endoplasmic reticulum stress	IMP	30451898
GO:1905897	Process	Regulation of response to endoplasmic reticulum stress	ISS
GO:2000194	Process	Regulation of female gonad development	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	27031958
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	ISS

Other IDs

• MIM: 614812
• HGNC: 29990
• e!Ensembl: ENSG00000176046

Protein

• UniProt ID: O60356
• Protein name: Nuclear protein 1 (Candidate of metastasis 1) (Protein p8)
• Protein function: Transcription regulator that converts stress signals into a program of gene expression that empowers cells with resistance to the stress induced by a change in their microenvironment. Thereby participates in regulation of many process namely cell-cycle, apoptosis, autophagy and DNA repair responses (PubMed:16478804, PubMed:19650074, PubMed:16300740, PubMed:19723804, PubMed:11056169, PubMed:22858377, PubMed:11940591, PubMed:18690848, PubMed:22565310, PubMed:20181828, PubMed:30451898). Controls cell cycle progression and protects cells from genotoxic stress induced by doxorubicin through the complex formation with TP53 and EP300 that binds CDKN1A promoter leading to transcriptional induction of CDKN1A (PubMed:18690848). Protects pancreatic cancer cells from stress-induced cell death by binding the RELB promoter and activating its transcription, leading to IER3 transactivation (PubMed:22565310). Negatively regulates apoptosis through interaction with PTMA (PubMed:16478804). Inhibits autophagy-induced apoptosis in cardiac cells through FOXO3 interaction, inducing cytoplasmic translocation of FOXO3 thereby preventing the FOXO3 association with the pro-autophagic BNIP3 promoter (PubMed:20181828). Inhibits cell growth and facilitates programmed cell death by apoptosis after adriamycin-induced DNA damage through transactivation of TP53 (By similarity). Regulates methamphetamine-induced apoptosis and autophagy through DDIT3-mediated endoplasmic reticulum stress pathway (By similarity). Participates in DNA repair following gamma-irradiation by facilitating DNA access of the transcription machinery through interaction with MSL1 leading to inhibition of histone H4' Lys-16' acetylation (H4K16ac) (PubMed:19650074). Coactivator of PAX2 transcription factor activity, both by recruiting EP300 to increase PAX2 transcription factor activity and by binding PAXIP1 to suppress PAXIP1-induced inhibition on PAX2 (PubMed:11940591). Positively regulates cell cycle progression through interaction with COPS5 inducing cytoplasmic translocation of CDKN1B leading to the CDKN1B degradation (PubMed:16300740). Coordinates, through its interaction with EP300, the assiociation of MYOD1, EP300 and DDX5 to the MYOG promoter, leading to inhibition of cell-cycle progression and myogenic differentiation promotion (PubMed:19723804). Negatively regulates beta cell proliferation via inhibition of cell-cycle regulatory genes expression through the suppression of their promoter activities (By similarity). Also required for LHB expression and ovarian maturation (By similarity). Exacerbates CNS inflammation and demyelination upon cuprizone treatment (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10195	Phospho_p8	21 → 77	DNA-binding nuclear phosphoprotein p8	Family

• Sequence:

  MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPG
  GHERKLVTKLQNSERKKRGARR

• Sequence length: 82

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Disease name	Disease term	References
	Heart Failure, Diastolic	29556499
	Lipoidosis	17175557
	Pancreatitis	16822955