GAP43 (growth associated protein 43)

Gene

• Entrez ID: 2596
• Gene name: Growth associated protein 43
• Gene symbol: GAP43
• Synonyms: B-50, GAP-43, PP46
• Chromosome: 3
• Chromosome location: 3q13.31
• Summary: The protein encoded by this gene has been termed a `growth` or `plasticity` protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT489932	hsa-miR-890	PAR-CLIP	23592263
MIRT489931	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT489930	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT489929	hsa-miR-3125	PAR-CLIP	23592263
MIRT489928	hsa-miR-3916	PAR-CLIP	23592263
MIRT489927	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT489926	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT735583	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32095982
MIRT489932	hsa-miR-890	PAR-CLIP	23592263
MIRT489931	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT489930	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT489929	hsa-miR-3125	PAR-CLIP	23592263
MIRT489928	hsa-miR-3916	PAR-CLIP	23592263
MIRT489927	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT489926	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT1011993	hsa-miR-1293	CLIP-seq
MIRT1011994	hsa-miR-3153	CLIP-seq
MIRT1011995	hsa-miR-4483	CLIP-seq
MIRT1011996	hsa-miR-4668-5p	CLIP-seq
MIRT1011997	hsa-miR-4727-3p	CLIP-seq
MIRT1011998	hsa-miR-3202	CLIP-seq
MIRT1011999	hsa-miR-4475	CLIP-seq
MIRT1012000	hsa-miR-4476	CLIP-seq
MIRT1012001	hsa-miR-4796-3p	CLIP-seq
MIRT1012002	hsa-miR-759	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT2537045	hsa-miR-1261	CLIP-seq
MIRT2537046	hsa-miR-130a	CLIP-seq
MIRT2537047	hsa-miR-130b	CLIP-seq
MIRT2537048	hsa-miR-148a	CLIP-seq
MIRT2537049	hsa-miR-148b	CLIP-seq
MIRT2537050	hsa-miR-152	CLIP-seq
MIRT2537051	hsa-miR-188-3p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT2537052	hsa-miR-301a	CLIP-seq
MIRT2537053	hsa-miR-301b	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT2537054	hsa-miR-3666	CLIP-seq
MIRT2537055	hsa-miR-3671	CLIP-seq
MIRT2537056	hsa-miR-3918	CLIP-seq
MIRT2537057	hsa-miR-4295	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT2537058	hsa-miR-454	CLIP-seq
MIRT2537059	hsa-miR-4696	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9139733, 25893612, 30664241, 32814053
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	3272162
GO:0009611	Process	Response to wounding	TAS	3272162
GO:0010001	Process	Glial cell differentiation	IEA
GO:0014069	Component	Postsynaptic density	IBA	21873635
GO:0016198	Process	Axon choice point recognition	IBA	21873635
GO:0030425	Component	Dendrite	IEA
GO:0031103	Process	Axon regeneration	IBA	21873635
GO:0031527	Component	Filopodium membrane	IDA	14978216
GO:0032584	Component	Growth cone membrane	IEA
GO:0035727	Function	Lysophosphatidic acid binding	IBA	21873635
GO:0040008	Process	Regulation of growth	IEA
GO:0042246	Process	Tissue regeneration	IBA	21873635
GO:0043204	Component	Perikaryon	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0051489	Process	Regulation of filopodium assembly	IDA	14978216
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099150	Process	Regulation of postsynaptic specialization assembly	IEA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IBA	21873635

Other IDs

• MIM: 162060
• HGNC: 4140
• e!Ensembl: ENSG00000172020

Protein

• UniProt ID: P17677
• Protein name: Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)
• Protein function: This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction. {ECO:0000269|PubMed:14978216, ECO:0000269|PubMed
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10580	Neuromodulin_N	2 → 31	Gap junction protein N-terminal region	Domain
  PF00612	IQ	32 → 52	IQ calmodulin-binding motif	Motif
  PF06614	Neuromodulin	67 → 238	Neuromodulin	Family

• Sequence:

  MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
  AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT
  EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT
  TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

• Sequence length: 238

Pathways

Reactome:

L1CAM interactions

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15059925
Hirschsprung disease	Hirschsprung Disease	rs104893891, rs76262710, rs75075748, rs75996173, rs79014735, rs77316810, rs75076352, rs76087194, rs76534745, rs76764689, rs76449634, rs78098482, rs79661516, rs104894389, rs769735757, rs267606780, rs1568823467, rs377767412, rs193922699, rs75030001, rs606231342, rs1553540620, rs759944122, rs1057519322, rs1057519323, rs1057519052, rs1588873476, rs1588866040, rs1838178869	22325380
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	17012697, 22138049, 21145444, 11208668

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		11208668
Dysthymic disorder	Dysthymic Disorder		11072752
Grand mal status epilepticus	Grand Mal Status Epilepticus		10366005
Hodgkin disease	Hodgkin Disease		22325380
Huntington disease	Huntington Disease	rs768047421	22325380
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	9774774
Mood disorder	Mood Disorders		18615010
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		10366005
Petit mal status	Petit mal status		10366005
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		10366005