FYN (FYN proto-oncogene, Src family tyrosine kinase)

Gene

• Entrez ID: 2534
• Gene name: FYN proto-oncogene, Src family tyrosine kinase
• Gene symbol: FYN
• Synonyms: SLK, SYN, p59-FYN
• Chromosome: 6
• Chromosome location: 6q21
• Summary: This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022048	hsa-miR-128-3p	Microarray	17612493
MIRT038910	hsa-miR-93-3p	CLASH	23622248
MIRT437821	hsa-miR-125a-3p	Luciferase reporter assay	23606749
MIRT437821	hsa-miR-125a-3p	Luciferase reporter assay	23606749
MIRT699208	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT699207	hsa-miR-34c-3p	HITS-CLIP	23313552
MIRT699205	hsa-miR-6760-3p	HITS-CLIP	23313552
MIRT699206	hsa-miR-1208	HITS-CLIP	23313552
MIRT699204	hsa-miR-431-5p	HITS-CLIP	23313552
MIRT699203	hsa-miR-584-5p	HITS-CLIP	23313552
MIRT699202	hsa-miR-3924	HITS-CLIP	23313552
MIRT699201	hsa-miR-500a-3p	HITS-CLIP	23313552
MIRT699200	hsa-let-7a-2-3p	HITS-CLIP	23313552
MIRT699199	hsa-let-7g-3p	HITS-CLIP	23313552
MIRT732298	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	27520374
MIRT732298	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	27520374
MIRT699208	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT699207	hsa-miR-34c-3p	HITS-CLIP	23313552
MIRT699205	hsa-miR-6760-3p	HITS-CLIP	23313552
MIRT699206	hsa-miR-1208	HITS-CLIP	23313552
MIRT699204	hsa-miR-431-5p	HITS-CLIP	23313552
MIRT699203	hsa-miR-584-5p	HITS-CLIP	23313552
MIRT699202	hsa-miR-3924	HITS-CLIP	23313552
MIRT699201	hsa-miR-500a-3p	HITS-CLIP	23313552
MIRT699200	hsa-let-7a-2-3p	HITS-CLIP	23313552
MIRT699199	hsa-let-7g-3p	HITS-CLIP	23313552
MIRT1007638	hsa-miR-3159	CLIP-seq
MIRT1007639	hsa-miR-33a	CLIP-seq
MIRT1007640	hsa-miR-33b	CLIP-seq
MIRT2536015	hsa-miR-2053	CLIP-seq
MIRT2536016	hsa-miR-4282	CLIP-seq
MIRT2536015	hsa-miR-2053	CLIP-seq
MIRT2536016	hsa-miR-4282	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000304	Process	Response to singlet oxygen	ISS	27525436
GO:0001764	Process	Neuron migration	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0003015	Process	Heart process	IGI	27525436
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 9799234, 11448999, 12923167, 18697750, 27692963
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IMP	16979591
GO:0004713	Function	Protein tyrosine kinase activity	ISS	17526495
GO:0004713	Function	Protein tyrosine kinase activity	TAS	17526495, 28386764
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	7822789
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	1661130, 1715582, 7685273, 7687537, 9045636, 9195899, 9360983, 9763511, 10209036, 10383400, 10409671, 10790433, 10867021, 11741929, 12721299, 12788081, 14757743, 14993658, 15784897, 16115884, 16374509, 16479011, 16636290, 16713569, 16777849, 16831868, 16899217, 16964398, 16966330, 17
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	ISS	27525436
GO:0005739	Component	Mitochondrion	ISS	27525436
GO:0005768	Component	Endosome	IDA	15611048
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IDA	12150984, 15611048
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	NAS	7822789
GO:0006468	Process	Protein phosphorylation	TAS	25707991
GO:0006816	Process	Calcium ion transport	NAS	7822789
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007411	Process	Axon guidance	TAS
GO:0007596	Process	Blood coagulation	TAS
GO:0007612	Process	Learning	TAS	1361685
GO:0007631	Process	Feeding behavior	TAS	8264796
GO:0008360	Process	Regulation of cell shape	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010730	Process	Negative regulation of hydrogen peroxide biosynthetic process	ISS	27525436
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	16979591, 27520374
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS	27525436
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	TAS	25707991
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019899	Function	Enzyme binding	IPI	27525436
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030425	Component	Dendrite	ISS
GO:0030900	Process	Forebrain development	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031295	Process	T cell costimulation	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	1361685
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IEA
GO:0042542	Process	Response to hydrogen peroxide	ISS	27525436
GO:0042608	Function	T cell receptor binding	IEA
GO:0042609	Function	CD4 receptor binding	IEA
GO:0042610	Function	CD8 receptor binding	IEA
GO:0042802	Function	Identical protein binding	IPI	14993658, 25156556, 27001024
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0044297	Component	Cell body	ISS
GO:0044325	Function	Ion channel binding	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	IDA	12150984
GO:0045121	Component	Membrane raft	IMP	23386614
GO:0045121	Component	Membrane raft	ISS
GO:0045121	Component	Membrane raft	TAS	28386764
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	10498895
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048156	Function	Tau protein binding	ISS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048156	Function	Tau protein binding	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	27525436
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	IDA	7722293
GO:0050900	Process	Leukocyte migration	TAS
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051428	Function	Peptide hormone receptor binding	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070851	Function	Growth factor receptor binding	IPI	16479011
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS	27525436
GO:0097062	Process	Dendritic spine maintenance	TAS	25707991
GO:0097386	Component	Glial cell projection	ISS
GO:0097718	Function	Disordered domain specific binding	IPI	9351809
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900449	Process	Regulation of glutamate receptor signaling pathway	ISS
GO:1901216	Process	Positive regulation of neuron death	ISS
GO:1902951	Process	Negative regulation of dendritic spine maintenance	ISS
GO:1903202	Process	Negative regulation of oxidative stress-induced cell death	ISS	27525436
GO:1903997	Process	Positive regulation of non-membrane spanning protein tyrosine kinase activity	TAS
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IMP	27520374
GO:1905232	Process	Cellular response to L-glutamate	ISS	17526495
GO:1905430	Process	Cellular response to glycine	ISS	17526495
GO:1905477	Process	Positive regulation of protein localization to membrane	TAS	28386764
GO:1905664	Process	Regulation of calcium ion import across plasma membrane	ISS
GO:2001056	Process	Positive regulation of cysteine-type endopeptidase activity	ISS	17526495
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

Other IDs

• MIM: 137025
• HGNC: 4037
• e!Ensembl: ENSG00000010810

Protein

• UniProt ID: P06241
• Protein name: Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)
• Protein function: Non-receptor tyrosine-protein kinase that plays a role in many biological processes including regulation of cell growth and survival, cell adhesion, integrin-mediated signaling, cytoskeletal remodeling, cell motility, immune response and axon gu
• PDB: 1A0N, 1AOT, 1AOU, 1AVZ, 1AZG, 1EFN, 1FYN, 1G83, 1M27, 1NYF, 1NYG, 1SHF, 1ZBJ, 2DQ7, 2MQI, 2MRJ, 2MRK, 3H0F, 3H0H, 3H0I, 3UA6, 3UA7, 4D8D, 4EIK, 4U17, 4U1P, 4ZNX, 5ZAU, 6EDF, 6IPY, 6IPZ, 7A2J, 7A2K, 7A2L, 7A2M, 7A2N, 7A2O, 7A2P, 7A2Q, 7A2R, 7A2S, 7A2T, 7A2U, 7A2V, 7A2W, 7A2X, 7A2Y, 7A2Z, 7UD6, 8KDX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	88 → 135	SH3 domain	Domain
  PF00017	SH2	149 → 231	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	271 → 520	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
  LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
  EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
  TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
  RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
  LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
  ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
  TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
  RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

• Sequence length: 537

Pathways

KEGG:

Sphingolipid signaling pathway
Phospholipase D signaling pathway
Axon guidance
Osteoclast differentiation
Focal adhesion
Adherens junction
Platelet activation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Cholinergic synapse
Prion disease
Pathogenic Escherichia coli infection
Viral myocarditis

Reactome:

GPVI-mediated activation cascade
Signaling by ERBB2
PIP3 activates AKT signaling
Signaling by SCF-KIT
Regulation of KIT signaling
Nef and signal transduction
Cell surface interactions at the vascular wall
FCGR activation
PECAM1 interactions
Constitutive Signaling by Aberrant PI3K in Cancer
DAP12 signaling
Nephrin family interactions
NCAM signaling for neurite out-growth
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
CTLA4 inhibitory signaling
EPHB-mediated forward signaling
EPHA-mediated growth cone collapse
Ephrin signaling
EPH-ephrin mediated repulsion of cells
Sema3A PAK dependent Axon repulsion
SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
CRMPs in Sema3A signaling
DCC mediated attractive signaling
VEGFA-VEGFR2 Pathway
Dectin-2 family
CD209 (DC-SIGN) signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Platelet Adhesion to exposed collagen
Reelin signalling pathway
NTRK2 activates RAC1
Regulation of signaling by CBL
FCGR3A-mediated IL10 synthesis
FCGR3A-mediated phagocytosis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605	30595370
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	30658076
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	28991256, 19102774, 19501919, 30285260

Unknown
Disease name	Disease term	dbSNP ID	References
Alveolitis	Alveolitis, Fibrosing		30658076
Bipolar disorder	Bipolar Disorder		19468241, 19330793
Catalepsy	Catalepsy		16407246
Metastatic melanoma	Metastatic melanoma
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		16367923
T-cell lymphoma	Peripheral T-Cell Lymphoma		24413734
T-cell lymphoma/leukemia	Adult T-Cell Lymphoma/Leukemia		26437031