GediPNet logo

NR5A2 (nuclear receptor subfamily 5 group A member 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2494
Gene nameGene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 5 group A member 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
NR5A2
SynonymsGene synonyms aliases
B1F, B1F2, CPF, FTF, FTZ-F1, FTZ-F1beta, LRH-1, LRH1, hB1F-2
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cho
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023720 hsa-miR-1-3p Microarray 18668037
MIRT054410 hsa-miR-139-5p Luciferase reporter assay, qRT-PCR, Western blot 24204738
MIRT446057 hsa-miR-548aa PAR-CLIP 22100165
MIRT446056 hsa-miR-548ap-3p PAR-CLIP 22100165
MIRT446055 hsa-miR-548t-3p PAR-CLIP 22100165
Transcription factors
Transcription factor Regulation Reference
CREB1 Activation 18191017
ESR1 Unknown 16091743
FOXA2 Activation 11595170
NR5A2 Activation 18191017
PROX1 Repression 19264593
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 15205472
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O00482
Protein name Nuclear receptor subfamily 5 group A member 2 (Alpha-1-fetoprotein transcription factor) (B1-binding factor) (hB1F) (CYP7A promoter-binding factor) (Hepatocytic transcription factor) (Liver receptor homolog 1) (LRH-1)
Protein function Orphan nuclear receptor that binds DNA as a monomer to the 5'-TCAAGGCCA-3' sequence and controls expression of target genes: regulates key biological processes, such as early embryonic development, cholesterol and bile acid synthesis pathways, a
PDB 1YOK , 1YUC , 1ZDU , 2A66 , 3PLZ , 3TX7 , 4DOR , 4DOS , 4IS8 , 4ONI , 4PLD , 4PLE , 4RWV , 5L0M , 5L11 , 5SYZ , 5UNJ , 6OQX , 6OQY , 6OR1 , 6VC2 , 6VIF , 7JYD , 7JYE , 7TT8 , 8F8M , 8PKI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4
84 153
Zinc finger, C4 type (two domains)
Domain
PF00104 Hormone_recep
330 523
Ligand-binding domain of nuclear hormone receptor
Domain
Sequence
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKL
EAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLN
GDVPYNNLLIEMLHAKR
A
Sequence length 541
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Maturity onset diabetes of the young   Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
Estrogen-dependent gene expression
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 28067908, 26192919
Nasopharyngeal carcinoma Nasopharyngeal carcinoma rs200046052 20512145
Pancreatic cancer Malignant neoplasm of pancreas rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431, rs200612497 20101243, 26098869
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Unknown
Disease name Disease term dbSNP ID References
Ankylosing spondylitis Ankylosing spondylitis 26974007
Cholangitis Cholangitis, Sclerosing 26974007
Crohn disease Crohn Disease rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438 26974007
Dyslipidemias Dyslipidemias 29515023

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412