IL27 (interleukin 27)

Gene

• Entrez ID: 246778
• Gene name: Interleukin 27
• Gene symbol: IL27
• Synonyms: IL-27, IL-27A, IL27A, IL27p28, IL30, p28
• Chromosome: 16
• Chromosome location: 16p12.1-p11.2
• Summary: The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017242	hsa-miR-335-5p	Microarray	18185580
MIRT1064686	hsa-miR-1538	CLIP-seq
MIRT1064687	hsa-miR-328	CLIP-seq
MIRT1064688	hsa-miR-338-3p	CLIP-seq
MIRT1064689	hsa-miR-4488	CLIP-seq
MIRT1064690	hsa-miR-4697-5p	CLIP-seq
MIRT1064691	hsa-miR-4745-3p	CLIP-seq
MIRT2015386	hsa-miR-1207-5p	CLIP-seq
MIRT2015387	hsa-miR-1909	CLIP-seq
MIRT2015388	hsa-miR-4447	CLIP-seq
MIRT2015389	hsa-miR-4472	CLIP-seq
MIRT2015390	hsa-miR-4489	CLIP-seq
MIRT2015391	hsa-miR-4763-3p	CLIP-seq
MIRT2015392	hsa-miR-486-3p	CLIP-seq
MIRT2451757	hsa-miR-3131	CLIP-seq
MIRT2451758	hsa-miR-3184	CLIP-seq
MIRT2451759	hsa-miR-423-5p	CLIP-seq
MIRT2451760	hsa-miR-4751	CLIP-seq
MIRT2451761	hsa-miR-611	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Activation	17684041;20083668
IRF9	Repression	20083668
STAT1	Unknown	22761702

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	19933857, 20974977
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	12734330
GO:0042129	Process	Regulation of T cell proliferation	IBA	21873635
GO:0042129	Process	Regulation of T cell proliferation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045523	Function	Interleukin-27 receptor binding	IBA	21873635
GO:0045523	Function	Interleukin-27 receptor binding	ISS
GO:0045625	Process	Regulation of T-helper 1 cell differentiation	IBA	21873635
GO:0045625	Process	Regulation of T-helper 1 cell differentiation	IDA	12734330
GO:0070106	Process	Interleukin-27-mediated signaling pathway	TAS

Other IDs

• MIM: 608273
• HGNC: 19157
• e!Ensembl: ENSG00000197272

Protein

• UniProt ID: Q8NEV9
• Protein name: Interleukin-27 subunit alpha (IL-27 subunit alpha) (IL-27-A) (IL27-A) (Interleukin-30) (p28)
• Protein function: Associates with EBI3 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimula
• PDB: 7U7N, 7ZXK, 8D85, 8XWY
• Sequence:

  MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
  VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
  GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
  LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
  PQP

• Sequence length: 243

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Th17 cell differentiation

Reactome:

Interleukin-27 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	19430480
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	23128233, 26192919
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	21801027, 24028178
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007

Unknown
Disease name	Disease term	dbSNP ID	References
Ankylosing spondylitis	Ankylosing spondylitis		26974007
Autoimmune diabetes	Diabetes, Autoimmune		19430480
Cholangitis	Cholangitis, Sclerosing		26974007
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26192919, 26974007, 30500874
Brittle diabetes mellitus	Brittle diabetes		19430480
Prostatic neoplasms	Prostatic Neoplasms		24028178, 21801027
Ulcerative colitis	Ulcerative Colitis		26974007, 26192919