ALOX12 (arachidonate 12-lipoxygenase, 12S type)

Gene

• Entrez ID: 239
• Gene name: Arachidonate 12-lipoxygenase, 12S type
• Gene symbol: ALOX12
• Synonyms: 12-LOX, 12S-LOX, LOG12
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on different polyunsaturated fatty acid substrates to generate bioactive lipid mediators including eicosanoids and lipoxins. The encoded enzyme and its reaction pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437657	hsa-miR-195-5p	Microarray, qRT-PCR	22815788
MIRT438332	hsa-miR-185-5p	Luciferase reporter assay, Western blot	24070899
MIRT438332	hsa-miR-185-5p	Luciferase reporter assay, Western blot	24070899
MIRT1929912	hsa-miR-15a	CLIP-seq
MIRT1929913	hsa-miR-15b	CLIP-seq
MIRT1929914	hsa-miR-16	CLIP-seq
MIRT1929915	hsa-miR-195	CLIP-seq
MIRT1929916	hsa-miR-424	CLIP-seq
MIRT1929917	hsa-miR-4496	CLIP-seq
MIRT1929918	hsa-miR-4524	CLIP-seq
MIRT1929919	hsa-miR-497	CLIP-seq
MIRT1929920	hsa-miR-503	CLIP-seq
MIRT1929921	hsa-miR-646	CLIP-seq
MIRT1929922	hsa-miR-651	CLIP-seq
MIRT1929923	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Unknown	14518567
RUNX1	Unknown	20181616
SP1	Activation	9164849
SP1	Unknown	14518567;16118214
SP3	Activation	9164849
STAT6	Unknown	10657944

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IBA	21873635
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IDA	1851637, 2217179, 2377602, 8319693, 17493578, 18311922, 22984144, 24282679
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10727209
GO:0005737	Component	Cytoplasm	IDA	8319693
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	8912711, 15107407
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006629	Process	Lipid metabolic process	IDA	17493578, 18311922, 22984144
GO:0007568	Process	Aging	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	IMP	23578768
GO:0016020	Component	Membrane	IDA	8912711
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IBA	21873635
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IDA	8319693
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA	21873635
GO:0019369	Process	Arachidonic acid metabolic process	IBA	21873635
GO:0019369	Process	Arachidonic acid metabolic process	IDA	1851637, 8319693
GO:0019369	Process	Arachidonic acid metabolic process	ISS
GO:0019372	Process	Lipoxygenase pathway	IBA	21873635
GO:0019372	Process	Lipoxygenase pathway	IDA	8319693
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0019395	Process	Fatty acid oxidation	IDA	17493578, 18311922, 22984144, 23504711, 24282679, 25036362
GO:0019395	Process	Fatty acid oxidation	IMP	15111312
GO:0033559	Process	Unsaturated fatty acid metabolic process	IDA	23504711, 24282679, 25036362
GO:0034440	Process	Lipid oxidation	IBA	21873635
GO:0042383	Component	Sarcolemma	IBA	21873635
GO:0042383	Component	Sarcolemma	IDA	15107407
GO:0042554	Process	Superoxide anion generation	NAS	15107407
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IEA
GO:0043651	Process	Linoleic acid metabolic process	IBA	21873635
GO:0043651	Process	Linoleic acid metabolic process	IDA	8319693
GO:0043651	Process	Linoleic acid metabolic process	IDA	1851637
GO:0047977	Function	Hepoxilin-epoxide hydrolase activity	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IBA	21873635
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IDA	17493578, 18311922
GO:0051121	Process	Hepoxilin metabolic process	TAS
GO:0051122	Process	Hepoxilin biosynthetic process	IBA	21873635
GO:0051122	Process	Hepoxilin biosynthetic process	ISS
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071396	Process	Cellular response to lipid	IEA
GO:0090331	Process	Negative regulation of platelet aggregation	ISS
GO:1901751	Process	Leukotriene A4 metabolic process	IDA	8250832
GO:1901751	Process	Leukotriene A4 metabolic process	IDA	1851637
GO:1905956	Process	Positive regulation of endothelial tube morphogenesis	IEA
GO:2001301	Process	Lipoxin biosynthetic process	TAS
GO:2001303	Process	Lipoxin A4 biosynthetic process	IDA	8250832
GO:2001306	Process	Lipoxin B4 biosynthetic process	IDA	8250832

Other IDs

• MIM: 152391
• HGNC: 429
• e!Ensembl: ENSG00000108839

Protein

• UniProt ID: P18054
• Protein name: Polyunsaturated fatty acid lipoxygenase ALOX12 (EC 1.13.11.-) (Arachidonate (12S)-lipoxygenase) (12S-LOX) (12S-lipoxygenase) (EC 1.13.11.31) (Arachidonate (15S)-lipoxygenase) (EC 1.13.11.33) (Linoleate (13S)-lipoxygenase) (Lipoxin synthase 12-LO) (EC 3.3.
• Protein function: Catalyzes the regio and stereo-specific incorporation of molecular oxygen into free and esterified polyunsaturated fatty acids generating lipid hydroperoxides that can be further reduced to the corresponding hydroxy species (PubMed:17493578, Pub
• PDB: 3D3L, 8GHB, 8GHC, 8GHD, 8GHE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01477	PLAT	4 → 108	PLAT/LH2 domain	Domain
  PF00305	Lipoxygenase	174 → 649	Lipoxygenase	Domain

• Sequence:

  MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
  QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
  LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
  GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
  LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
  VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
  LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
  GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
  LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
  AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
  QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
  VTI

• Sequence length: 663

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels

Reactome:

Synthesis of Hepoxilins (HX) and Trioxilins (TrX)
Synthesis of Lipoxins (LX)
Synthesis of 12-eicosatetraenoic acid derivatives
Biosynthesis of DHA-derived SPMs
Biosynthesis of DPAn-6 SPMs
Biosynthesis of DPAn-3-derived maresins

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20626912

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		12664313
Dermatologic disorders	Dermatologic disorders		22533443
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Nervous system diseases	Peripheral Nervous System Diseases		20864405
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504