GediPNet logo

KCNE4 (potassium voltage-gated channel subfamily E regulatory subunit 4)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23704
Gene nameGene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel subfamily E regulatory subunit 4
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
KCNE4
SynonymsGene synonyms aliases
MIRP3
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q36.1
SummarySummary of gene provided in NCBI Entrez Gene.
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT681728 hsa-miR-4778-5p HITS-CLIP 23706177
MIRT681727 hsa-miR-939-3p HITS-CLIP 23706177
MIRT681726 hsa-miR-1285-3p HITS-CLIP 23706177
MIRT681725 hsa-miR-3187-5p HITS-CLIP 23706177
MIRT681724 hsa-miR-5189-5p HITS-CLIP 23706177
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005251 Function Delayed rectifier potassium channel activity IBA 21873635
GO:0005515 Function Protein binding IPI 19687231, 20533308, 32296183
GO:0008076 Component Voltage-gated potassium channel complex IBA 21873635
GO:0015459 Function Potassium channel regulator activity IBA 21873635
GO:0016324 Component Apical plasma membrane IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q8WWG9
Protein name Potassium voltage-gated channel subfamily E member 4 (MinK-related peptide 3) (MiRP3) (Minimum potassium ion channel-related peptide 3) (Potassium channel subunit beta MiRP3)
Protein function Ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE4 beta subunit modulates the gatin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02060 ISK_Channel
46 137
Slow voltage-gated potassium channel
Family
Sequence
MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNS
THPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSL
LLLYKDEERLWGEAMKP
LPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSES
SSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS
Sequence length 221
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Phase 3 - rapid repolarisation
Phase 2 - plateau phase
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 21790008
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412