PADI4 (peptidyl arginine deiminase 4)

Gene

• Entrez ID: 23569
• Gene name: Peptidyl arginine deiminase 4
• Gene symbol: PADI4
• Synonyms: PAD, PAD4, PADI5, PDI4, PDI5
• Chromosome: 1
• Chromosome location: 1p36.13
• Summary: This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [prov

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017912	hsa-miR-335-5p	Microarray	18185580
MIRT2060295	hsa-miR-1915	CLIP-seq
MIRT2060296	hsa-miR-338-5p	CLIP-seq
MIRT2060297	hsa-miR-4270	CLIP-seq
MIRT2060298	hsa-miR-4441	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004668	Function	Protein-arginine deiminase activity	IBA	21873635
GO:0004668	Function	Protein-arginine deiminase activity	IDA	15339660, 16567635, 21584310
GO:0004668	Function	Protein-arginine deiminase activity	IMP	15247907
GO:0005509	Function	Calcium ion binding	IDA	16567635
GO:0005509	Function	Calcium ion binding	IMP	15247907
GO:0005515	Function	Protein binding	IPI	21584310, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15339660
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	ISS
GO:0006325	Process	Chromatin organization	TAS
GO:0006334	Process	Nucleosome assembly	ISS
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006464	Process	Cellular protein modification process	TAS	10488123
GO:0018101	Process	Protein citrullination	IDA	21584310
GO:0018101	Process	Protein citrullination	IMP	15247907
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0032991	Component	Protein-containing complex	IMP	15247907
GO:0034618	Function	Arginine binding	IMP	15247907
GO:0036413	Process	Histone H3-R26 citrullination	IDA	15339660, 16567635
GO:0036414	Process	Histone citrullination	IBA	21873635
GO:0036414	Process	Histone citrullination	IDA	15339660, 16567635
GO:0042802	Function	Identical protein binding	IPI	15247907
GO:0045087	Process	Innate immune response	IEA

Other IDs

• MIM: 605347
• HGNC: 18368
• e!Ensembl: ENSG00000159339

Protein

• UniProt ID: Q9UM07
• Protein name: Protein-arginine deiminase type-4 (EC 3.5.3.15) (HL-60 PAD) (Peptidylarginine deiminase IV) (Protein-arginine deiminase type IV)
• Protein function: Catalyzes the citrullination/deimination of arginine residues of proteins such as histones, thereby playing a key role in histone code and regulation of stem cell maintenance (PubMed:15339660, PubMed:15345777, PubMed:16567635, PubMed:21245532).
• PDB: 1WD8, 1WD9, 1WDA, 2DEW, 2DEX, 2DEY, 2DW5, 3APM, 3APN, 3B1T, 3B1U, 4DKT, 4X8C, 4X8G, 5N0M, 5N0Y, 5N0Z, 5N1B, 8GOD, 8R8U, 8R8V, 8SMK, 8SML
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08526	PAD_N	1 → 111	Protein-arginine deiminase (PAD) N-terminal domain	Domain
  PF08527	PAD_M	113 → 273	Protein-arginine deiminase (PAD) middle domain	Domain
  PF03068	PAD	283 → 660	Protein-arginine deiminase (PAD)	Family

• Sequence:

  MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKK
  KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCAD
  ITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDM
  SLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV
  PGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
  NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAP
  HKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG
  KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVP
  APDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNS
  FVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK
  PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVRRKPFSFKWWN
  MVP

• Sequence length: 663

Pathways

KEGG:

Neutrophil extracellular trap formation

Reactome:

Chromatin modifying enzymes

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	12376462
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	24390342, 23143596, 21452313, 21505073, 30423114, 24532676
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771, rs766602945, rs1601419986, rs1489114116, rs754904956, rs755007390, rs368615054

Unknown
Disease name	Disease term	dbSNP ID	References
Anaplastic carcinoma	Anaplastic carcinoma		12376462
Drachtman weinblatt sitarz syndrome	Congenital neurologic anomalies