DDAH2 (DDAH family member 2, ADMA-independent)

Gene

• Entrez ID: 23564
• Gene name: DDAH family member 2, ADMA-independent
• Gene symbol: DDAH2
• Synonyms: DDAH, DDAHII, G6a, HEL-S-277, NG30
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be loc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025565	hsa-miR-34a-5p	Proteomics	21566225
MIRT928703	hsa-miR-1321	CLIP-seq
MIRT928704	hsa-miR-3130-5p	CLIP-seq
MIRT928705	hsa-miR-331-3p	CLIP-seq
MIRT928706	hsa-miR-3681	CLIP-seq
MIRT928707	hsa-miR-3922-5p	CLIP-seq
MIRT928708	hsa-miR-3974	CLIP-seq
MIRT928709	hsa-miR-4251	CLIP-seq
MIRT928710	hsa-miR-4303	CLIP-seq
MIRT928711	hsa-miR-4329	CLIP-seq
MIRT928712	hsa-miR-4419a	CLIP-seq
MIRT928713	hsa-miR-4435	CLIP-seq
MIRT928714	hsa-miR-4446-5p	CLIP-seq
MIRT928715	hsa-miR-4482	CLIP-seq
MIRT928716	hsa-miR-4510	CLIP-seq
MIRT928717	hsa-miR-4530	CLIP-seq
MIRT928718	hsa-miR-4739	CLIP-seq
MIRT928719	hsa-miR-4753-5p	CLIP-seq
MIRT928720	hsa-miR-4755-3p	CLIP-seq
MIRT928721	hsa-miR-4755-5p	CLIP-seq
MIRT928722	hsa-miR-4756-5p	CLIP-seq
MIRT928723	hsa-miR-501-5p	CLIP-seq
MIRT928724	hsa-miR-659	CLIP-seq
MIRT1975048	hsa-miR-1179	CLIP-seq
MIRT1975049	hsa-miR-150	CLIP-seq
MIRT1975050	hsa-miR-4291	CLIP-seq
MIRT1975051	hsa-miR-4310	CLIP-seq
MIRT1975052	hsa-miR-4461	CLIP-seq
MIRT1975053	hsa-miR-4684-5p	CLIP-seq
MIRT1975054	hsa-miR-4713-5p	CLIP-seq
MIRT1975055	hsa-miR-532-3p	CLIP-seq
MIRT1975056	hsa-miR-606	CLIP-seq
MIRT928703	hsa-miR-1321	CLIP-seq
MIRT928704	hsa-miR-3130-5p	CLIP-seq
MIRT2210454	hsa-miR-3162-3p	CLIP-seq
MIRT2210455	hsa-miR-361-3p	CLIP-seq
MIRT928706	hsa-miR-3681	CLIP-seq
MIRT928709	hsa-miR-4251	CLIP-seq
MIRT928710	hsa-miR-4303	CLIP-seq
MIRT928711	hsa-miR-4329	CLIP-seq
MIRT928712	hsa-miR-4419a	CLIP-seq
MIRT928714	hsa-miR-4446-5p	CLIP-seq
MIRT928715	hsa-miR-4482	CLIP-seq
MIRT928716	hsa-miR-4510	CLIP-seq
MIRT2210456	hsa-miR-4639-3p	CLIP-seq
MIRT928718	hsa-miR-4739	CLIP-seq
MIRT928721	hsa-miR-4755-5p	CLIP-seq
MIRT928722	hsa-miR-4756-5p	CLIP-seq
MIRT928723	hsa-miR-501-5p	CLIP-seq
MIRT928724	hsa-miR-659	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000052	Process	Citrulline metabolic process	IBA	21873635
GO:0000052	Process	Citrulline metabolic process	IDA	10493931
GO:0003824	Function	Catalytic activity	TAS	10493931
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 22046132, 32296183
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006525	Process	Arginine metabolic process	IBA	21873635
GO:0006527	Process	Arginine catabolic process	IEA
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	10493931
GO:0007263	Process	Nitric oxide mediated signal transduction	TAS	10493931
GO:0016403	Function	Dimethylargininase activity	IBA	21873635
GO:0016403	Function	Dimethylargininase activity	IDA	10493931
GO:0016597	Function	Amino acid binding	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IBA	21873635
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0050999	Process	Regulation of nitric-oxide synthase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 604744
• HGNC: 2716
• e!Ensembl: ENSG00000213722

Protein

• UniProt ID: O95865
• Protein name: Putative hydrolase DDAH2 (EC 3.-.-.-) (DDAHII) (Inactive N(G),N(G)-dimethylarginine dimethylaminohydrolase 2) (DDAH-2) (Inactive dimethylarginine dimethylaminohydrolase 2) (Protein G6a) (S-phase protein)
• Protein function: Putative hydrolase with unknown substrate (Probable). Does not hydrolyze N(G),N(G)-dimethyl-L-arginine (ADMA) which acts as an inhibitor of NOS (PubMed:21493890, PubMed:37296100). In endothelial cells, induces expression of vascular endothelial
• Sequence:

  MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
  LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
  NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
  PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
  DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS

• Sequence length: 285

Pathways

Reactome:

eNOS activation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	17267746

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary arteriosclerosis	Coronary Arteriosclerosis		17267746