DDAH2 (dimethylarginine dimethylaminohydrolase 2)

Gene

• Entrez ID: 23564
• Gene name: Dimethylarginine dimethylaminohydrolase 2
• Gene symbol: DDAH2
• Synonyms: DDAH, DDAHII, G6a, HEL-S-277, NG30
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants. [provided by RefSeq, Dec 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025565	hsa-miR-34a-5p	Proteomics	21566225

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000052	Process	Citrulline metabolic process	IBA	21873635
GO:0000052	Process	Citrulline metabolic process	IDA	10493931
GO:0003824	Function	Catalytic activity	TAS	10493931
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 22046132, 32296183
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006525	Process	Arginine metabolic process	IBA	21873635
GO:0006527	Process	Arginine catabolic process	IEA
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	10493931
GO:0007263	Process	Nitric oxide mediated signal transduction	TAS	10493931
GO:0016403	Function	Dimethylargininase activity	IBA	21873635
GO:0016403	Function	Dimethylargininase activity	IDA	10493931
GO:0016597	Function	Amino acid binding	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IBA	21873635
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0050999	Process	Regulation of nitric-oxide synthase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 604744
• HGNC: 2716
• e!Ensembl: ENSG00000213722

Protein

• UniProt ID: O95865
• Protein name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 (DDAH-2) (Dimethylarginine dimethylaminohydrolase 2) (EC 3.5.3.18) (DDAHII) (Dimethylargininase-2) (Protein G6a) (S-phase protein)
• Protein function: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
• Sequence:

  MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
  LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
  NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
  PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
  DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS

• Sequence length: 285

Pathways

Reactome:

eNOS activation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	17267746

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary arteriosclerosis	Coronary Arteriosclerosis		17267746