CDK20 (cyclin dependent kinase 20)

Gene

• Entrez ID: 23552
• Gene name: Cyclin dependent kinase 20
• Gene symbol: CDK20
• Synonyms: CCRK, CDCH, P42, PNQALRE
• Chromosome: 9
• Chromosome location: 9q22.1
• Summary: The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants enc

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs745561217	A>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant, intron variant
rs1057519438	C>G,T	Pathogenic	Intron variant, missense variant, coding sequence variant, stop gained, synonymous variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017181	hsa-miR-335-5p	Microarray	18185580
MIRT039839	hsa-miR-615-3p	CLASH	23622248
MIRT880945	hsa-miR-450b-3p	CLIP-seq
MIRT880946	hsa-miR-4661-5p	CLIP-seq
MIRT880947	hsa-miR-769-3p	CLIP-seq
MIRT2500978	hsa-miR-1208	CLIP-seq
MIRT2500979	hsa-miR-1225-5p	CLIP-seq
MIRT2500980	hsa-miR-124	CLIP-seq
MIRT2500981	hsa-miR-1243	CLIP-seq
MIRT2500982	hsa-miR-1292	CLIP-seq
MIRT2500983	hsa-miR-1972	CLIP-seq
MIRT2500984	hsa-miR-199a-3p	CLIP-seq
MIRT2500985	hsa-miR-199b-3p	CLIP-seq
MIRT2500986	hsa-miR-2117	CLIP-seq
MIRT2500987	hsa-miR-3129-5p	CLIP-seq
MIRT2500988	hsa-miR-342-3p	CLIP-seq
MIRT2500989	hsa-miR-3622a-3p	CLIP-seq
MIRT2500990	hsa-miR-3622b-3p	CLIP-seq
MIRT2500991	hsa-miR-3652	CLIP-seq
MIRT2500992	hsa-miR-3670	CLIP-seq
MIRT2500993	hsa-miR-3714	CLIP-seq
MIRT2500994	hsa-miR-3910	CLIP-seq
MIRT2500995	hsa-miR-3921	CLIP-seq
MIRT2500996	hsa-miR-4251	CLIP-seq
MIRT2500997	hsa-miR-4255	CLIP-seq
MIRT2500998	hsa-miR-4273	CLIP-seq
MIRT2500999	hsa-miR-4279	CLIP-seq
MIRT2501000	hsa-miR-4284	CLIP-seq
MIRT2501001	hsa-miR-4329	CLIP-seq
MIRT2501002	hsa-miR-4430	CLIP-seq
MIRT2501003	hsa-miR-4471	CLIP-seq
MIRT2501004	hsa-miR-4505	CLIP-seq
MIRT2501005	hsa-miR-4539	CLIP-seq
MIRT2501006	hsa-miR-4646-5p	CLIP-seq
MIRT2501007	hsa-miR-4653-5p	CLIP-seq
MIRT2501008	hsa-miR-4724-5p	CLIP-seq
MIRT2501009	hsa-miR-4764-5p	CLIP-seq
MIRT2501010	hsa-miR-4786-5p	CLIP-seq
MIRT2501011	hsa-miR-506	CLIP-seq
MIRT2501012	hsa-miR-544b	CLIP-seq
MIRT2501013	hsa-miR-548aa	CLIP-seq
MIRT2501014	hsa-miR-548ag	CLIP-seq
MIRT2501015	hsa-miR-548ai	CLIP-seq
MIRT2501016	hsa-miR-580	CLIP-seq
MIRT2501017	hsa-miR-598	CLIP-seq
MIRT2501018	hsa-miR-647	CLIP-seq
MIRT2501019	hsa-miR-760	CLIP-seq
MIRT2501020	hsa-miR-767-3p	CLIP-seq
MIRT2501021	hsa-miR-885-3p	CLIP-seq
MIRT2501022	hsa-miR-922	CLIP-seq
MIRT2501023	hsa-miR-936	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	21747169
AR	Activation	21747169

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	21986944, 26871637
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005929	Component	Cilium	IEA
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0007049	Process	Cell cycle	IEA
GO:0007275	Process	Multicellular organism development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA

Other IDs

• MIM: 610076
• HGNC: 21420
• e!Ensembl: ENSG00000156345

Protein

• UniProt ID: Q8IZL9
• Protein name: Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42)
• Protein function: Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in resp
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	4 → 288	Protein kinase domain	Domain

• Sequence:

  MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMED
  NQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHA
  NNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQ
  YDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKI
  SFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSEL
  PIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG

• Sequence length: 346

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Attention deficit hyperactivity disorder	Attention deficit hyperactivity disorder	rs120074176, rs786205019
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Kidney disease	Chronic Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	29773874

Unknown
Disease name	Disease term	dbSNP ID	References
Obsessive-compulsive disorder	Obsessive compulsive behavior