RASD2 (RASD family member 2)

Gene

• Entrez ID: 23551
• Gene name: RASD family member 2
• Gene symbol: RASD2
• Synonyms: Rhes, TEM2
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: This gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the prote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT448097	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448095	hsa-miR-4804-3p	PAR-CLIP	22100165
MIRT448096	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448094	hsa-miR-3915	PAR-CLIP	22100165
MIRT448093	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT448092	hsa-miR-4689	PAR-CLIP	22100165
MIRT448091	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT448090	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448097	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448095	hsa-miR-4804-3p	PAR-CLIP	22100165
MIRT448096	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448094	hsa-miR-3915	PAR-CLIP	22100165
MIRT448093	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT448092	hsa-miR-4689	PAR-CLIP	22100165
MIRT448091	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT448090	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448097	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448095	hsa-miR-4804-3p	PAR-CLIP	22100165
MIRT448096	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448094	hsa-miR-3915	PAR-CLIP	22100165
MIRT448093	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT448092	hsa-miR-4689	PAR-CLIP	22100165
MIRT448091	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT448090	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448097	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448095	hsa-miR-4804-3p	PAR-CLIP	22100165
MIRT448096	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448094	hsa-miR-3915	PAR-CLIP	22100165
MIRT448093	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT448092	hsa-miR-4689	PAR-CLIP	22100165
MIRT448091	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT448090	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1292155	hsa-miR-128	CLIP-seq
MIRT1292156	hsa-miR-1281	CLIP-seq
MIRT1292157	hsa-miR-3183	CLIP-seq
MIRT1292158	hsa-miR-3945	CLIP-seq
MIRT1292159	hsa-miR-4253	CLIP-seq
MIRT1292160	hsa-miR-4254	CLIP-seq
MIRT1292161	hsa-miR-4268	CLIP-seq
MIRT1292162	hsa-miR-4448	CLIP-seq
MIRT1292163	hsa-miR-4667-5p	CLIP-seq
MIRT1292164	hsa-miR-4670-3p	CLIP-seq
MIRT1292165	hsa-miR-4700-5p	CLIP-seq
MIRT1292166	hsa-miR-4708-5p	CLIP-seq
MIRT1292167	hsa-miR-4723-3p	CLIP-seq
MIRT1292168	hsa-miR-637	CLIP-seq
MIRT1292169	hsa-miR-765	CLIP-seq
MIRT2086851	hsa-miR-2467-3p	CLIP-seq
MIRT2086852	hsa-miR-342-5p	CLIP-seq
MIRT2086853	hsa-miR-4664-5p	CLIP-seq
MIRT2086854	hsa-miR-665	CLIP-seq
MIRT2311760	hsa-miR-101	CLIP-seq
MIRT2311761	hsa-miR-144	CLIP-seq
MIRT2311762	hsa-miR-147b	CLIP-seq
MIRT2311763	hsa-miR-24	CLIP-seq
MIRT2311764	hsa-miR-2682	CLIP-seq
MIRT2311765	hsa-miR-296-3p	CLIP-seq
MIRT2311766	hsa-miR-3065-3p	CLIP-seq
MIRT2311767	hsa-miR-3119	CLIP-seq
MIRT2311768	hsa-miR-3130-5p	CLIP-seq
MIRT2311769	hsa-miR-3663-3p	CLIP-seq
MIRT2311770	hsa-miR-3663-5p	CLIP-seq
MIRT2311771	hsa-miR-4269	CLIP-seq
MIRT2311772	hsa-miR-4482	CLIP-seq
MIRT2311773	hsa-miR-449c	CLIP-seq
MIRT2311774	hsa-miR-4514	CLIP-seq
MIRT2311775	hsa-miR-4527	CLIP-seq
MIRT2311776	hsa-miR-4532	CLIP-seq
MIRT2311777	hsa-miR-4633-3p	CLIP-seq
MIRT2311778	hsa-miR-4692	CLIP-seq
MIRT2311779	hsa-miR-4731-5p	CLIP-seq
MIRT2311780	hsa-miR-4738-5p	CLIP-seq
MIRT2311781	hsa-miR-4742-5p	CLIP-seq
MIRT2311782	hsa-miR-558	CLIP-seq
MIRT2311783	hsa-miR-582-5p	CLIP-seq
MIRT2311784	hsa-miR-658	CLIP-seq
MIRT2086854	hsa-miR-665	CLIP-seq
MIRT2311785	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	NAS	11976265
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IEA
GO:0031681	Function	G-protein beta-subunit binding	IPI	19255495
GO:0033235	Process	Positive regulation of protein sumoylation	ISS
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0043949	Process	Regulation of cAMP-mediated signaling	ISS
GO:0051897	Process	Positive regulation of protein kinase B signaling	ISS

Other IDs

• MIM: 612842
• HGNC: 18229
• e!Ensembl: ENSG00000100302

Protein

• UniProt ID: Q96D21
• Protein name: GTP-binding protein Rhes (Ras homolog enriched in striatum) (Tumor endothelial marker 2)
• Protein function: GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly loco
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	21 → 191	Ras family	Domain

• Sequence:

  MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVY
  NIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVK
  SCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVD
  EMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSV
  NSDLKYIKAKVLREGQARERDKCTIQ

• Sequence length: 266

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	18571626, 23555897