FOSB (FosB proto-oncogene, AP-1 transcription factor subunit)

Gene

• Entrez ID: 2354
• Gene name: FosB proto-oncogene, AP-1 transcription factor subunit
• Gene symbol: FOSB
• Synonyms: AP-1, G0S3, GOS3, GOSB
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have bee

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003234	hsa-miR-224-5p	Luciferase reporter assay	20065103
MIRT006087	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006087	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006087	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT1001127	hsa-miR-139-3p	CLIP-seq
MIRT1001128	hsa-miR-193a-5p	CLIP-seq
MIRT1001129	hsa-miR-2392	CLIP-seq
MIRT1001130	hsa-miR-3192	CLIP-seq
MIRT1001131	hsa-miR-4314	CLIP-seq
MIRT1001132	hsa-miR-450b-3p	CLIP-seq
MIRT1001133	hsa-miR-4646-5p	CLIP-seq
MIRT1001134	hsa-miR-4713-3p	CLIP-seq
MIRT1001135	hsa-miR-4772-5p	CLIP-seq
MIRT1001136	hsa-miR-638	CLIP-seq
MIRT1001137	hsa-miR-769-3p	CLIP-seq
MIRT1001138	hsa-miR-1207-3p	CLIP-seq
MIRT1001139	hsa-miR-1207-5p	CLIP-seq
MIRT1001140	hsa-miR-148a	CLIP-seq
MIRT1001141	hsa-miR-148b	CLIP-seq
MIRT1001142	hsa-miR-152	CLIP-seq
MIRT1001143	hsa-miR-182	CLIP-seq
MIRT1001144	hsa-miR-298	CLIP-seq
MIRT1001145	hsa-miR-3135b	CLIP-seq
MIRT1001146	hsa-miR-4709-5p	CLIP-seq
MIRT1001147	hsa-miR-4736	CLIP-seq
MIRT1001148	hsa-miR-4763-3p	CLIP-seq
MIRT1001139	hsa-miR-1207-5p	CLIP-seq
MIRT1996611	hsa-miR-4279	CLIP-seq
MIRT1001147	hsa-miR-4736	CLIP-seq
MIRT1001148	hsa-miR-4763-3p	CLIP-seq
MIRT1996612	hsa-miR-508-5p	CLIP-seq
MIRT1996613	hsa-miR-766	CLIP-seq
MIRT1001139	hsa-miR-1207-5p	CLIP-seq
MIRT2230627	hsa-miR-1286	CLIP-seq
MIRT1001147	hsa-miR-4736	CLIP-seq
MIRT1001148	hsa-miR-4763-3p	CLIP-seq
MIRT2534700	hsa-miR-3184	CLIP-seq
MIRT2534701	hsa-miR-3936	CLIP-seq
MIRT2534702	hsa-miR-423-5p	CLIP-seq
MIRT2534703	hsa-miR-4434	CLIP-seq
MIRT2534704	hsa-miR-4516	CLIP-seq
MIRT2534705	hsa-miR-4651	CLIP-seq
MIRT2534706	hsa-miR-608	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT6	Unknown	18342537

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	1900040
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	TAS	1900040
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 32911434
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	22387553
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0008134	Function	Transcription factor binding	TAS	1900040
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043278	Process	Response to morphine	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 164772
• HGNC: 3797
• e!Ensembl: ENSG00000125740

Protein

• UniProt ID: P53539
• Protein name: Protein FosB (FosB proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 3) (Transcription factor AP-1 subunit FosB)
• Protein function: Heterodimerizes with proteins of the JUN family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to gene promoters containing an AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing their transcription
• PDB: 5VPA, 5VPB, 5VPC, 5VPD, 5VPE, 5VPF, 6UCI, 6UCL, 6UCM, 7UCC, 7UCD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	153 → 213	bZIP transcription factor	Coiled-coil

• Sequence:

  MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
  ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
  GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
  DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
  LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
  TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL

• Sequence length: 338

Pathways

KEGG:

Osteoclast differentiation
IL-17 signaling pathway
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

Estrogen-dependent gene expression
NGF-stimulated transcription

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	16391389
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	27935865

Unknown
Disease name	Disease term	dbSNP ID	References
Cognitive disorder	Cognition Disorders		24067299
Dyskinesia	Dyskinesia, Drug-Induced		17219962
Impulse control disorder	Disruptive, Impulse Control, and Conduct Disorders		18539927
Intermittent explosive disorder	Intermittent Explosive Disorder		18539927
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Liver neoplasms	Liver neoplasms		26411935
Liver cancer	Malignant neoplasm of liver		26411935
Liver carcinoma	Liver carcinoma		28284560
Lung neoplasms	Lung Neoplasms		27935865
Mood disorder	Mood Disorders		21679928
Movement disorders	Movement Disorders		10600402
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Status marmoratus	Etat Marbre		10600402
Still disease	Juvenile-Onset Still Disease		19565504