FOLR2 (folate receptor beta)

Gene

• Entrez ID: 2350
• Gene name: Folate receptor beta
• Gene symbol: FOLR2
• Synonyms: BETA-HFR, FBP, FBP/PL-1, FOLR1, FR-BETA, FR-P3, FRbeta
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017234	hsa-miR-335-5p	Microarray	18185580
MIRT029090	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IDA	25015955
GO:0005542	Function	Folic acid binding	IDA	4066659, 19116913, 25015955
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	NAS	25015955
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19116913
GO:0009986	Component	Cell surface	IDA	25015955
GO:0015884	Process	Folic acid transport	IDA	4066659
GO:0031362	Component	Anchored component of external side of plasma membrane	IBA	21873635
GO:0031362	Component	Anchored component of external side of plasma membrane	IDA	4066659
GO:0035036	Process	Sperm-egg recognition	IBA	21873635
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0046655	Process	Folic acid metabolic process	TAS
GO:0051870	Function	Methotrexate binding	IDA	19116913
GO:0061714	Function	Folic acid receptor activity	IC	4066659
GO:0061714	Function	Folic acid receptor activity	IDA	4066659
GO:0071231	Process	Cellular response to folic acid	IEA
GO:1904447	Process	Folate import across plasma membrane	IEA

Other IDs

• MIM: 136425
• HGNC: 3793
• e!Ensembl: ENSG00000165457

Protein

• UniProt ID: P14207
• Protein name: Folate receptor beta (FR-beta) (Folate receptor 2) (Folate receptor, fetal/placental) (Placental folate-binding protein) (FBP)
• Protein function: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
• PDB: 4KMY, 4KMZ, 4KN0, 4KN1, 4KN2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03024	Folate_rec	30 → 205	Folate receptor family	Domain

• Sequence:

  MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
  TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
  ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
  ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
  LLLSLALMLQLWLLG

• Sequence length: 255

Pathways

KEGG:

Antifolate resistance
Endocytosis
Folate transport and metabolism

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins
Metabolism of folate and pterines

Associated diseases

Disease name	Disease term	References
	Acrania	11749123
	Iniencephaly	11749123
	Exencephaly	11749123
	Malignant neoplasm of breast
	Craniorachischisis	11749123
	Diastematomyelia	11749123
	Neural Tube Defects	11749123
	Neurenteric Cyst	11749123
	Non-alcoholic Fatty Liver Disease	30794826
	Nonalcoholic Steatohepatitis	30794826
	Tethered Cord Syndrome	11749123
	Spinal Cord Myelodysplasia	11749123