ABCB9 (ATP binding cassette subfamily B member 9)

Gene

• Entrez ID: 23457
• Gene name: ATP binding cassette subfamily B member 9
• Gene symbol: ABCB9
• Synonyms: EST122234, TAPL
• Chromosome: 12
• Chromosome location: 12q24.31
• Summary: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003169	hsa-miR-210-3p	immunoprecipitaion, Microarray, qRT-PCR	19826008
MIRT018865	hsa-miR-335-5p	Microarray	18185580
MIRT050137	hsa-miR-26a-5p	CLASH	23622248
MIRT437432	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	24099915
MIRT437432	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	24099915
MIRT758243	hsa-miR-1324	CLIP-seq
MIRT758244	hsa-miR-1470	CLIP-seq
MIRT758245	hsa-miR-203	CLIP-seq
MIRT758246	hsa-miR-4287	CLIP-seq
MIRT758247	hsa-miR-4469	CLIP-seq
MIRT758248	hsa-miR-4497	CLIP-seq
MIRT758249	hsa-miR-4667-3p	CLIP-seq
MIRT758250	hsa-miR-4685-3p	CLIP-seq
MIRT758251	hsa-miR-4757-5p	CLIP-seq
MIRT758252	hsa-miR-671-5p	CLIP-seq
MIRT758253	hsa-miR-922	CLIP-seq
MIRT2165143	hsa-miR-1321	CLIP-seq
MIRT2165144	hsa-miR-24	CLIP-seq
MIRT2165145	hsa-miR-3194-5p	CLIP-seq
MIRT2165146	hsa-miR-4435	CLIP-seq
MIRT2165147	hsa-miR-4739	CLIP-seq
MIRT2165148	hsa-miR-4749-3p	CLIP-seq
MIRT2165149	hsa-miR-4756-5p	CLIP-seq
MIRT2165150	hsa-miR-483-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IDA	17977821
GO:0005515	Function	Protein binding	IPI	22641697
GO:0005524	Function	ATP binding	IDA	15863492
GO:0005764	Component	Lysosome	IDA	22641697
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	10748049, 17977821, 18952056
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005769	Component	Early endosome	IDA	17977821
GO:0005783	Component	Endoplasmic reticulum	IDA	17977821
GO:0015031	Process	Protein transport	IEA
GO:0015433	Function	ABC-type peptide antigen transporter activity	IBA	21873635
GO:0015440	Function	ABC-type peptide transporter activity	IBA	21873635
GO:0015440	Function	ABC-type peptide transporter activity	IDA	17977821, 18434309, 22641697
GO:0015833	Process	Peptide transport	IBA	21873635
GO:0015833	Process	Peptide transport	IDA	17977821, 18434309, 22641697
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IDA	18434309
GO:0016887	Function	ATPase activity	IEA
GO:0019885	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I	IBA	21873635
GO:0022857	Function	Transmembrane transporter activity	IDA	18434309
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IDA	11011155, 15577206
GO:0042288	Function	MHC class I protein binding	IBA	21873635
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IBA	21873635
GO:0042803	Function	Protein homodimerization activity	IDA	18434309
GO:0042803	Function	Protein homodimerization activity	IPI	18952056
GO:0042824	Component	MHC class I peptide loading complex	IBA	21873635
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0046978	Function	TAP1 binding	IBA	21873635
GO:0055085	Process	Transmembrane transport	IBA	21873635
GO:0055085	Process	Transmembrane transport	TAS

Other IDs

• MIM: 605453
• HGNC: 50
• e!Ensembl: ENSG00000150967

Protein

• UniProt ID: Q9NP78
• Protein name: ABC-type oligopeptide transporter ABCB9 (EC 7.4.2.6) (ATP-binding cassette sub-family B member 9) (ATP-binding cassette transporter 9) (ABC transporter 9 protein) (hABCB9) (TAP-like protein) (TAPL)
• Protein function: ATP-dependent low-affinity peptide transporter which translocates a broad spectrum of peptides from the cytosol to the lysosomal lumen for degradation (PubMed:15863492, PubMed:17977821, PubMed:18434309, PubMed:22641697, PubMed:25646430, PubMed:3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00664	ABC_membrane	188 → 457	ABC transporter transmembrane region	Family
  PF00005	ABC_tran	522 → 671	ABC transporter	Domain

• Sequence:

  MRLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCL
  LLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMVKLLLFSEVRRPIRDPWFWALF
  VWTYISLGASFLLWWLLSTVRPGTQALEPGAATEAEGFPGSGRPPPEQASGATLQKLLSY
  TKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLAIGSS
  FAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLV
  SQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNA
  LARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTL
  LVVQVSILYYGGHLVISGQMTSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVF
  EFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGP
  SGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNI
  SYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRN
  PPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQ
  QGTHQQLLAQGGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA

• Sequence length: 766

Pathways

KEGG:

ABC transporters
Lysosome

Reactome:

ABC-family proteins mediated transport

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	24509480, 28869590