GediPNet logo

SIRT3 (sirtuin 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23410
Gene nameGene Name - the full gene name approved by the HGNC.
Sirtuin 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SIRT3
SynonymsGene synonyms aliases
SIR2L3
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
SummarySummary of gene provided in NCBI Entrez Gene.
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent th
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT732205 hsa-miR-421 Luciferase reporter assay 27107702
MIRT732205 hsa-miR-421 Luciferase reporter assay 27107702
MIRT734872 hsa-miR-505-3p Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunocytochemistry (ICC) 33385630
MIRT734872 hsa-miR-505-3p Luciferase reporter assay, Western blotting, qRT-PCR 34646424
MIRT1350159 hsa-miR-1 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003950 Function NAD+ ADP-ribosyltransferase activity TAS 17456799
GO:0005515 Function Protein binding IPI 16788062, 19343720, 19535340, 22770219, 23283301, 24344202, 29445193, 32814053
GO:0005634 Component Nucleus IBA 21873635
GO:0005654 Component Nucleoplasm TAS
GO:0005739 Component Mitochondrion IDA 16079181
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9NTG7
Protein name NAD-dependent protein deacetylase sirtuin-3, mitochondrial (hSIRT3) (EC 2.3.1.286) (NAD-dependent protein delactylase sirtuin-3) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 3) (SIR2-like protein 3)
Protein function NAD-dependent protein deacetylase (PubMed:12186850, PubMed:12374852, PubMed:16788062, PubMed:18680753, PubMed:18794531, PubMed:19535340, PubMed:23283301, PubMed:24121500, PubMed:24252090). Activates or deactivates mitochondrial target proteins b
PDB 3GLR , 3GLS , 3GLT , 3GLU , 4BN4 , 4BN5 , 4BV3 , 4BVB , 4BVE , 4BVF , 4BVG , 4BVH , 4C78 , 4C7B , 4FVT , 4FZ3 , 4HD8 , 4JSR , 4JT8 , 4JT9 , 4O8Z , 5BWN , 5BWO , 5D7N , 5H4D , 5Y4H , 5YTK , 5Z93 , 5Z94 , 5ZGC , 6ISO , 8ANC , 8BBK , 8CCW , 8CCZ , 8HLW , 8HLY , 8HN9 , 8V15 , 8V2N , 8V5U , 9CBT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02146 SIR2
145 326
Sir2 family
Family
Sequence
MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEP
FASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Sequence length 399
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Nicotinate and nicotinamide metabolism
Metabolic pathways
Central carbon metabolism in cancer
  Transcriptional activation of mitochondrial biogenesis
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Regulation of FOXO transcriptional activity by acetylation
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 21472714
Obesity Obesity rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840 23956348
Unknown
Disease name Disease term dbSNP ID References
Mouth neoplasms Mouth Neoplasms 21472714
Malignant neoplasm of mouth Malignant neoplasm of mouth 21472714
Uterine fibroids Uterine Fibroids 30194396, 31649266
Plexiform leiomyoma Plexiform leiomyoma 31649266, 30194396

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412